Свойства и функции белка: Calaméo — Белки. Свойства и функции.

Содержание

Свойства и функции белков — презентация онлайн

1. Тема: «Свойства и функции белков»

Задачи:
Изучить свойства и функции белков
Пименов А.В.

2. 1. Свойства белков

1. Белки являются амфотерными соединениями, сочетают в себе
основные и кислотные свойства, определяемые радикалами
аминокислот. Различают кислые, основные и нейтральные белки.
Способность отдавать и присоединять Н+ определяют буферные
свойства белков, один из самых мощных буферов — гемоглобин в
эритроцитах, поддерживающий рН крови на постоянном уровне.
2. Есть белки растворимые, есть нерастворимые белки, выполняющие
механические функции (фиброин, кератин, коллаген).
3. Есть белки необычайно химически активные (ферменты), есть
химически неактивные.
4. Есть устойчивые к воздействию различных условий внешней среды и
крайне неустойчивые. Внешние факторы (изменение температуры,
солевого состава среды, рН, радиация) могут вызывать нарушение
структурной организации молекулы белка.
1. Свойства белков
5. Процесс утраты трехмерной конформации,
присущей данной молекуле белка, называют
денатурацией. Причиной денатурации является
разрыв связей, стабилизирующих определенную
структуру белка. Вместе с тем, денатурация не
сопровождается разрушением полипептидной
цепи.. Изменение пространственной
конфигурации приводит к изменению свойств
белка и, как следствие, делает невозможным
выполнение белком свойственных ему
биологических функций.
Денатурация может быть: обратимой, процесс
восстановления структуры белка после
денатурации называется ренатурацией. Если
восстановление пространственной
конфигурации белка невозможно, то
денатурация называется необратимой.
6. Разрушение первичной структуры белковой
молекулы называется деградацией.
Подведем итоги:
Какие белки называются кислыми?
Белки, в которых больше кислых аминокислот, понижающие рН.
Какие белки называются нейтральными?
Белки, в которых одинаковое количество карбоксильных и аминогрупп.
Почему белки являются мощными буферными системами?
Способны присоединять или отдавать ионы водорода, поддерживая
определенный уровень рН.
Что такое денатурация белка?
Процесс утраты трехмерной конформации, присущей данной молекуле
белка, называют денатурацией.
Что такое ренатурация?
Процесс восстановления структуры белка после денатурации называется
ренатурацией.
Приведите примеры растворимых и нерастворимых белков:
Растворимые (белки плазмы крови – фибриноген, протромбин, альбумин,
глобулины), нерастворимые белки, выполняющие механические функции
(фиброин, кератин, коллаген).
Приведите примеры белков, устойчивых к внешним воздействиям:
Фиброин – белок паутины, кератин – белки волос, коллаген – белок
сухожилий.
2. Функции белков
Благодаря сложности, разнообразию форм и состава, белки играют
важную роль в жизнедеятельности клетки и организма в целом.
1. Одна из важнейших — строительная. Белки участвуют в образовании
клеточных и внеклеточных структур: входят в состав клеточных
мембран, шерсти, волос, сухожилий, стенок сосудов и т.д.
2. Функции белков
2. Транспортная. Некоторые белки
способны присоединять
различные вещества и
переносить их к различным
тканям и органам тела, из одного
места клетки в другое.
Например, белок крови
гемоглобин транспортирует О2
и СО2;
в состав клеточных мембран
входят особые белки,
обеспечивают активный и
строго избирательный перенос
некоторых веществ и ионов из
клетки во внешнюю среду и
обратно.
2. Функции белков
3. Регуляторная. Большая группа белков организма
принимает участие в регуляции процессов обмена
веществ. Такими белками являются гормоны —
биологически активные вещества, выделяющиеся в
кровь железами внутренней секреции (гормоны
гипофиза, поджелудочной железы).
Например, гормон инсулин регулирует уровень
сахара в крови путем повышения проницаемости
клеточных мембран для глюкозы, способствует
синтезу гликогена.
4. Защитная. В ответ на проникновение в организм
чужеродных белков или микроорганизмов
(антигенов) образуются особые белки — антитела,
способные связывать и обезвреживать их. Фибрин,
образующийся из фибриногена, способствует
остановке кровотечений.
2. Функции белков
5. Двигательная. Особые сократительные белки (актин и миозин)
участвуют во всех видах движения клетки и организма: образовании
псевдоподий, мерцании ресничек и биении жгутиков у простейших,
сокращении мышц у многоклеточных животных, движении листьев у
растений и др.
2. Функции белков
6. Весьма важна для жизни клетки
сигнальная функция белков. В
поверхностную мембрану клетки
встроены молекулы белков,
способных изменять свою
третичную структуру в ответ на
действие факторов внешней
среды. Так происходит прием
сигналов из внешней среды и
передача команд в клетку.
2. Функции белков
7. Запасающая. Благодаря белкам в организме
могут откладываться про запас некоторые
вещества. Например, при распаде гемоглобина
железо не выводится из организма, а
сохраняется в организме, образуя комплекс с
белком ферритином. К запасным белкам
относятся белки яйца, белки молока.
8. Энергетическая. Белки являются одним из
источников энергии в клетке. При распаде 1 г
белка до конечных продуктов выделяется 17,6
кДж. Сначала белки распадаются до
аминокислот, а затем до конечных продуктов —
воды, углекислого газа и аммиака.
Однако в качестве источника энергии белки
используются тогда, когда другие (углеводы и
жиры) израсходованы.
2. Функции белков
9. Каталитическая. Одна из важнейших функций белков. Скорость
ферментативных реакций в десятки тысяч (а иногда и в миллионы раз)
выше скорости реакций, идущих с участием неорганических
катализаторов.
Например, пероксид водорода без катализаторов разлагается медленно:
2Н202 → 2Н20 + 02. В присутствии солей железа (катализатора) эта
реакция идет несколько быстрее. Фермент каталаза за 1 сек.
расщепляет до 100 тыс. молекул Н202.
Масса фермента гораздо больше массы субстрата, та часть молекулы
фермента, которая взаимодействует с молекулой субстрата получила
название – активный центр фермента.
2. Функции белков
Ферменты – глобулярные белки,
по особенностям строения
ферменты можно разделить на две
группы: простые и сложные.
Простые ферменты являются
простыми белками, т.е. состоят
только из аминокислот.
Сложные ферменты являются
сложными белками, т.е. в их состав
помимо белковой части входит
органическое соединение
небелковой природы —
коферменты: ионы металлов или
витамины.
2. Функции белков
Ферменты специфичны – могут
катализировать один тип реакций – в
активный центр попадает определенная
молекула субстрата.
Поскольку почти все ферменты
являются белками (есть рибозимы, РНК,
катализирующие некоторые реакции), их
активность наиболее высока при
физиологически нормальных условиях:
большинство ферментов наиболее
активно работает только при
определенной температуре, рН,
скорость зависит от концентрации
фермента и субстрата.
При повышении температуры до
некоторого значения (в среднем до 50°С)
каталитическая активность растет (на
каждые 10°С скорость реакции
повышается примерно в 2 раза).
Подведем итоги:
Строительная функция белков проявляется :
Белки входят в состав всех клеточных мембран и органоидов клетки.
Преимущественно из белка состоят стенки кровеносных сосудов, хрящи,
сухожилия, волосы и ногти..
Двигательную функцию выполняют:
особые сократительные белки в жгутиках, ресничках, мышцах.
Транспортная функция белков проявляется:
Транспортные белки в наружной мембране клеток переносят различные
вещества из окружающей среды в цитоплазму, гемоглобин миоглобин
транспортируют кислород.
Защитная функция белков проявляется в том, что:
Антитела, вырабатываемые лимфоцитами, блокируют чужеродные
белки; фибрин и тромбин предохраняют организм от кровопотери.
Регуляторная функция белков:
Белки-гормоны (гормоны гипофиза, поджелудочной железы) участвуют в
росте, размножении и других жизненно важных процессах. Например,
инсулин регулирует содержание сахара в крови.
Подведем итоги:
Сигнальная функция:
В мембрану клетки встроены белки, способные изменять свою третичную
структуру в ответ на действие факторов внешней среды. Так
происходит прием сигналов из внешней среды и передача информации в
клетку..
Энергетическая функция:
При полном расщеплении 1 г белка до конечных продуктов выделяется
17,6 кДж энергии. Однако в качестве источника энергии белки
используются крайне редко.
Каталитическая функция:
Белки — ферменты способны ускорять биохимические реакции в клетке в
десятки и сотни миллионов раз.
Кофермент:
Небелковое соединение, входящее в состав фермента. В качестве
коферментов выступают различные органические вещества, как правило
витамины, и неорганические — ионы различных металлов.
Подведем итоги:
Активный центр:
Небольшой участок, на котором идет данная
реакция, который взаимодействует с молекулой
субстрата..
Специфичность ферментов:
Форма и химическое строение активного центра
таковы, что с ним могут связываться только
определенные молекулы в силу их
комплементарности друг другу.
Зависимость скорости катализа от концентрации
фермента:
Чем больше концентрация фермента, тем больше
скорость.
Зависимость скорости катализа от концентрации
субстрата:
Чем больше концентрация субстрата, тем больше
скорость, но до насыщения активных центров.
Зависимость скорости катализа от температуры:
Повышение скорости катализа до 36 градусов,
затем понижение и при 60 градусах большинство
ферментов не функционирует.

Ответы | § 4. Свойства и функции белков — Биология, 11 класс

1. Чем простые белки отличаются от сложных? Фибриллярные от глобулярных? Приведите примеры фибриллярных и глобулярных белков.

Молекулы простых белков построены только из аминокислотных остатков. В состав сложных белков, кроме того, входит какой-либо компонент неаминокислотной природы.

Фибриллярными называют белки, молекулы которых имеют вытянутую, нитевидную форму (коллаген, кератин, миозин). Молекулы глобулярных белков имеют округлую форму (альбумины и глобулины крови, гемоглобин).

2. Как называется процесс нарушения природной структуры белка, при котором сохраняется его первичная структура? Действие каких факторов может приводить к нарушению структуры белковых молекул?

Процесс нарушения природной структуры белка, при котором сохраняется его первичная структура, называется денатурацией.

Действие высоких и низких температур, сильных кислот и щелочей, ионов тяжелых металлов, ультрафиолетового излучения, радиации может приводить к нарушению структуры белковых молекул.

3. Назовите основные биологические функции белков, приведите соответствующие примеры.

Биологические функции белков Примеры
Каталитическая
(ферментативная)
Пищеварительные ферменты липазы ускоряют расщепление
липидов, амилаза и мальтаза — углеводов, пепсин и трипсин — белков.
Структурная  Кератин — основной компонент волос, ногтей, когтей, копыт, рогов, перьев. Эластин входит в состав стенок артерий, связок и др., коллаген — в состав кожи, сухожилий, костной, хрящевой и других тканей.
Транспортная Дыхательный пигмент гемоглобин переносит кислород и углекислый газ в крови позвоночных животных, а у многих моллюсков и ряда членистоногих эту функцию выполняет гемоцианин.
Сократительная (двигательная) Белки актин и миозин обеспечивают сократимость гладкой и поперечнополосатой мышечных тканей.
Регуляторная Гормоны инсулин и глюкагон регулируют уровень глюкозы в крови. Процессы роста и физического развития человека протекают под контролем гормона соматотропина.
Сигнальная (рецепторная) Зрительные пигменты глаза — родопсин (содержится в палочках) и йодопсины (в колбочках) — обеспечивают восприятие света фоторецепторными клетками, их возбуждение и запуск нервного импульса.
Защитная Тромбопластин, тромбин и фибриноген обеспечивают
свертывание крови, защищая организм от кровопотери.
Иммуноглобулины (антитела) участвуют в иммунном ответе организма на чужеродные объекты — антигены. Лизоцим, содержащийся в слюне, слезной жидкости и др., обладает антибактериальными свойствами.
Токсическая Токсины, выделяемые многими бактериями (дифтерийный, ботулиновый, столбнячный, холерный и др.), по химической природе являются белками. Действующие вещества в составе ядов змей, некоторых пауков, скорпионов и насекомых также представляют собой белки.
Запасающая Резервные белки, которые откладываются в семенах растений. Миоглобин играет важную роль в создании кислородного запаса в мышечных волокнах.
Энергетическая При полном окислении 1 г белка выделяется 17,6 кДж
энергии.

4. Что представляют собой ферменты? Опишите механизм работы фермента.

Ферменты — это белки, которые выполняют функции биологических катализаторов, т. е. ускоряют протекание химических реакций в живых организмах.

Ферменты ускоряют химические реакции за счет тесного взаимодействия с молекулами субстратов — исходных реагирующих веществ. С субстратом (или субстратами) взаимодействует не вся молекула фермента, а лишь небольшой ее участок — активный центр. Чаще всего он образован несколькими аминокислотными остатками. Активный центр каждого фермента имеет особую форму и химическое строение, поэтому с ним
могут связываться лишь определенные субстраты. Присоединение субстрата вызывает небольшие изменения конфигурации активного центра — такие, чтобы максимально соответствовать субстрату. Функционально активные группы фермента, за счет которых будет протекать реакция, наиболее благоприятным образом располагаются в пространстве. В результате присоединения к активному центру молекула субстрата
особым образом располагается в пространстве, и в ее структуре ослабляются определенные химические связи. Реакционная способность субстрата возрастает. Образовавшиеся продукты отделяются от активного центра. После этого он может принимать новые молекулы субстрата.

5. В чем заключается специфичность ферментов? Какова ее причина? Почему ферменты активно функционируют лишь в определенном диапазоне температуры, рН и других факторов?

Специфичность ферментов заключается в том, что каждый фермент ускоряет только одну определенную реакцию или действует только на один тип связи. Причиной является соответствие активного центра фермента определенным субстратам.

Ферменты являются белками, поэтому активно работают лишь в определенном диапазоне температуры, рН и других факторов.

6. Почему белки, как правило, используются в качестве источников энергии лишь в крайних случаях, когда в клетках исчерпаны запасы углеводов и жиров?

Потому что белки выполняют очень важные биологические функции, многие из которых не могут выполнять ни углеводы, ни жиры. К тому же, при полном расщеплении белков образуются не только СО2 и Н2О (в отличие от углеводов и жиров), но и соединения азота и серы, причём некоторые из них токсичны для организма.

7. У многих бактерий в процессах синтеза веществ, необходимых для нормальной жизнедеятельности и размножения, участвует парааминобензойная кислота (ПАБК). В то же время в медицине для лечения ряда бактериальных инфекций используются сульфаниламиды — вещества, по структуре сходные с ПАБК. Как вы думаете, на чем основано лечебное действие сульфаниламидов?

С помощью фермента бактерии превращают ПАБК в продукт, который затем используется для синтеза необходимых ростовых факторов.

Из-за структурного сходства с ПАБК, сульфаниламиды также способны связываться с активным центром этого фермента, блокируя его работу. Это приводит к нарушению синтеза ростовых факторов и нуклеиновых кислот у бактерий.

Присоединяйтесь к Telegram-группе @superresheba_11, делитесь своими решениями и пользуйтесь материалами, которые присылают другие участники группы!

Строение, свойства и функции белков (контрольная работа)

План

1. Строение, свойства и функции белков

Строение белков

Свойства белков

Функции белков

2. Функции органоидов клетки

3. Клеточное дыхание и его строение

Литература

1. Строение, свойства и функции белков

Строение белков

Белки — высокомолекулярные органические соединения, состоящие из остатков α-аминокислот.

В состав белков входят углерод, водород, азот, кислород, сера. Часть белков образует комплексы с другими молекулами, содержащими фосфор, железо, цинк и медь.

Белки обладают большой молекулярной массой: яичный альбумин — 36 000, гемоглобин — 152 000, миозин — 500 000. Для сравнения: молекулярная масса спирта — 46, уксусной кислоты — 60, бензола — 78.

Аминокислотный состав белков

Белки — непериодические полимеры, мономерами которых являются α-аминокислоты. Обычно в качестве мономеров белков называют 20 видов α-аминокислот, хотя в клетках и тканях их обнаружено свыше 170.

В зависимости от того, могут ли аминокислоты синтезироваться в организме человека и других животных, различают: заменимые аминокислоты — могут синтезироваться; незаменимые аминокислоты — не могут синтезироваться. Незаменимые аминокислоты должны поступать в организм вместе с пищей. Растения синтезируют все виды аминокислот.

В зависимости от аминокислотного состава, белки бывают: полноценными — содержат весь набор аминокислот; неполноценными — какие-то аминокислоты в их составе отсутствуют. Если белки состоят только из аминокислот, их называют простыми. Если белки содержат помимо аминокислот еще и неаминокислотный компонент (простетическую группу), их называют сложными. Простетическая группа может быть представлена металлами (металлопротеины), углеводами (гликопротеины), липидами (липопротеины), нуклеиновыми кислотами (нуклеопротеины).

Свойства белков

Аминокислотный состав, структура белковой молекулы определяют его свойства. Белки сочетают в себе основные и кислотные свойства, определяемые радикалами аминокислот: чем больше кислых аминокислот в белке, тем ярче выражены его кислотные свойства. Способность отдавать и присоединять Н+ определяют буферные свойства белков; один из самых мощных буферов — гемоглобин в эритроцитах, поддерживающий рН крови на постоянном уровне. Есть белки растворимые (фибриноген), есть нерастворимые, выполняющие механические функции (фиброин, кератин, коллаген). Есть белки активные в химическом отношении (ферменты), есть химически неактивные, устойчивые к воздействию различных условий внешней среды и крайне неустойчивые.

Внешние факторы (нагревание, ультрафиолетовое излучение, тяжелые металлы и их соли, изменения рН, радиация, обезвоживание) могут вызывать нарушение структурной организации молекулы белка. Процесс утраты трехмерной конформации, присущей данной молекуле белка, называют денатурацией. Причиной денатурации является разрыв связей, стабилизирующих определенную структуру белка. Первоначально рвутся наиболее слабые связи, а при ужесточении условий и более сильные. Поэтому сначала утрачивается четвертичная, затем третичная и вторичная структуры. Изменение пространственной конфигурации приводит к изменению свойств белка и, как следствие, делает невозможным выполнение белком свойственных ему биологических функций. Если денатурация не сопровождается разрушением первичной структуры, то она может быть обратимой, в этом случае происходит самовосстановление свойственной белку конформации. Такой денатурации подвергаются, например, рецепторные белки мембраны. Процесс восстановления структуры белка после денатурации называется ренатурацией. Если восстановление пространственной конфигурации белка невозможно, то денатурация называется необратимой.

 
Функции белков

Функция

Примеры и пояснения

Строительная

Белки участвуют в образовании клеточных и внеклеточных структур: входят в состав клеточных мембран (липопротеины, гликопротеины), волос (кератин), сухожилий (коллаген) и т.д.

Транспортная

Белок крови гемоглобин присоединяет кислород и транспортирует его от легких ко всем тканям и органам, а от них в легкие переносит углекислый газ; в состав клеточных мембран входят особые белки, которые обеспечивают активный и строго избирательный перенос некоторых веществ и ионов из клетки во внешнюю среду и обратно.

Регуляторная

Гормоны белковой природы принимают участие в регуляции процессов обмена веществ. Например, гормон инсулин регулирует уровень глюкозы в крови, способствует синтезу гликогена, увеличивает образование жиров из углеводов.

Защитная

В ответ на проникновение в организм чужеродных белков или микроорганизмов (антигенов) образуются особые белки — антитела, способные связывать и обезвреживать их. Фибрин, образующийся из фибриногена, способствует остановке кровотечений.

Двигательная

Сократительные белки актин и миозин обеспечивают сокращение мышц у многоклеточных животных.

Сигнальная

В поверхностную мембрану клетки встроены молекулы белков, способных изменять свою третичную структуру в ответ на действие факторов внешней среды, таким образом осуществляя прием сигналов из внешней среды и передачу команд в клетку.

Запасающая

В организме животных белки, как правило, не запасаются, исключение: альбумин яиц, казеин молока. Но благодаря белкам в организме могут откладываться про запас некоторые вещества, например, при распаде гемоглобина железо не выводится из организма, а сохраняется, образуя комплекс с белком ферритином.

Энергетическая

При распаде 1 г белка до конечных продуктов выделяется 17,6 кДж. Сначала белки распадаются до аминокислот, а затем до конечных продуктов — воды, углекислого газа и аммиака. Однако в качестве источника энергии белки используются только тогда, когда другие источники (углеводы и жиры) израсходованы.

Каталитическая

Одна из важнейших функций белков. Обеспечивается белками — ферментами, которые ускоряют биохимические реакции, происходящие в клетках. Например, рибулезобифосфаткарбоксилаза катализирует фиксацию СО2 при фотосинтезе.

2. Функции органоидов клетки

Органоиды клетки и их функции:

. Клеточная оболочка — состоит из 3 слоев:

.        жесткая клеточная стенка;

2.      тонкий слой пектиновых веществ;

.        тонкая цитоплазматическая нить.

Клеточная оболочка обеспечивает механическую опору и защиту, скрепляет друг с другом соседние клетки, объединяет протопласты соседних клеток в единую систему.

. Плазматическая мембрана — имеет сложную структуру, состоит из расположенных определенным образом слоев липидов и белков. Обеспечивает избирательно проницаемый барьер, регулирующий обмен между клеткой и средой.

. Цитоплазма — внутренняя полужидкая среда клетки. В цитоплазме протекают процессы обмена веществ, она объединяет органоиды клетки в единое целое и обеспечивает их взаимодействие.

. Ядро — заключено в оболочку из двух мембран, компоненты ядра — клеточный сок, хроматин и ядрышко. Хромосомы ядра регулируют все виды клеточной активности: деление ядра лежит в основе самовоспроизведения.

. Ядрышко — небольшая структура, включенная в ядро. Ядрышко — это место образования рибосом.

. Эндоплазматический ретикулум (ЭР) — система уплощенных мембранных мешочков — цистерн. Поверхность шероховатого ЭР покрыта рибосомами, гладкого ЭР — нет. По цистернам шероховатого ЭР транспортируется белок, синтезированный на рибосомах. Гладкий ЭР — место синтеза липидов и стероидов.

. Рибосомы — состоят из 2 субчастиц — большой и малой. Могут быть связаны с ЭР или свободно лежать в цитоплазме. Рибосомы — место синтеза белков.

. Митохондрии — окружены оболочками из двух мембран. Внутренние мембраны образуют складки (кристы), внутреннее содержимое митохондрии — матрикс. Участвуют в процессах внутриклеточного окисления, обеспечивают энергетический запас.

. Аппарат Гольджи — стопка уплощенных мембранных мешочков цистерн с непрерывно отделяющимися пузырьками. Участвует в процессе секреции, в нем образуются лизосомы.

. Лизосомы — одномембранный мешочек, заполненный пищеварительными ферментами. Выполняют функции, связанные с распадом структур или молекул в клетке.

. Клеточный центр — состоит из 2 мельчайших частиц — центриолей. Участвует в образовании веретена деления.

. Пластиды — двухмембранный органоид растительной клетки. Хромопласты содержат пигменты, лейкопласты — запасное вещество (крахмал). Выполняют сигнальную (хромопласты) и запасную (лейкопласты) функции.

. Хлоропласты — крупная пластида, содержащая хлорофилл. Участвует в процессе фотосинтеза.

. Вакуоль — органоид содержит клеточный сок, ограничен одной мембраной. Выполняет запасающую функцию.

3. Клеточное дыхание и его строение

Клеточное дыхание <http://www.tryphonov.ru/tryphonov2/terms2/respir.htm>, или тканевое дыхание, или внутреннее дыхание — это совокупность <http://www.tryphonov.ru/tryphonov3/terms3/totalit.htm> управляемых <http://www.tryphonov.ru/tryphonov2/terms2/class.htm> окислительно-восстановительных реакций <http://www.tryphonov.ru/tryphonov2/terms2/respons.htm> в клетке <http://www.tryphonov.ru/tryphonov2/terms2/cl.htm>, главным назначением <http://www.tryphonov.ru/tryphonov6/terms6/predet.htm> и результатом <http://www.tryphonov.ru/tryphonov3/terms3/result.htm> которых является образование энергии <http://www.tryphonov.ru/tryphonov4/terms4/energ.htm>.

Окислительно-восстановительной реакцией называется процесс <http://www.tryphonov.ru/tryphonov3/terms3/randpr.htm> передачи электронов одним веществом <http://www.tryphonov.ru/tryphonov6/terms6/subst.htm> (атом, молекула, ион <http://www.tryphonov.ru/tryphonov5/terms5/ion.htm>) другому веществу. В соответствии с названием эта реакция состоит из двух синхронных <http://www.tryphonov.ru/tryphonov6/terms6/synchr.htm> взаимодействующих <http://www.tryphonov.ru/tryphonov4/terms4/interac.htm> конкурирующих обратимых процессов: окисление и восстановление. Окислением называется процесс отдачи одним веществом электронов другому веществу. Вещество, которое является донором электронов называется восстановителем и обозначается Red. В результате <http://www.tryphonov.ru/tryphonov3/terms3/result.htm> окислительно-восстановительной реакции восстановитель переходит в сопряжённую окисленную форму <http://www.tryphonov.ru/tryphonov6/terms6/form.htm>. Восстановлением называется процесс присоединения веществом электронов, отдаваемых другим веществом. Вещество акцептор электронов называется окислителем и обозначается Ox. В результате окислительно-восстановительной реакции окислителель переходит в сопряжённую восстановленную форму.

Представления <http://www.tryphonov.ru/tryphonov6/terms6/represe.htm> об окислительно-восстановительных реакциях подобны представлениям о кислотно-основных реакциях (теория Бренстеда-Лоури, Бренстед Йоханнес Николаус, Bronsted, Johannes Nicolaus, 1879-1914, датский физикохимик; Лоури Томас Мартин, Lowry Thomas Martin, 1874-1936, английский химик). Кислота <http://www.tryphonov.ru/tryphonov5/terms5/acdbas.htm> является донором, а основание <http://www.tryphonov.ru/tryphonov5/terms5/acdbas.htm> акцептором протона. Кислоты и основания существуют только как сопряженные пары. Протон не существует в растворе <http://www.tryphonov.ru/tryphonov4/terms4/solut1.htm> в свободном виде, в воде <http://www.tryphonov.ru/tryphonov5/terms5/wat.htm> он образует ион <http://www.tryphonov.ru/tryphonov5/terms5/ion.htm> Oh4+. Главной особенностью кислотно-основных реакций является конкуренция за протоны между двумя парами сопряжённых кислот и оснований. Аналогично, главной особенностью окислительно-восстановительных реакций является конкуренция за электроны (как за протоны в кислотно-основных парах) между двумя парами сопряженных окислителей и восстановителей (редокс пары).

Характерным признаком <http://www.tryphonov.ru/tryphonov6/terms6/sign.htm> окислительно-восстановительных реакций является изменение степени окисленности вещества. Окисление сопровождается повышением степени окисленности вещества. Восстановление сопровождается понижением степени окисленности восстанавливаемого вещества. Окислительно-восстановительные реакции в организме <http://www.tryphonov.ru/tryphonov2/terms2/organis.htm> катализируются <http://www.tryphonov.ru/tryphonov5/terms5/cat.htm> ферментами <http://www.tryphonov.ru/tryphonov5/terms5/enz.htm> оксиредуктазами.

белок аминокислотный состав клеточный

Субстратами клеточного дыхания являются питательные вещества <http://www.tryphonov.ru/tryphonov2/terms2/nutrs.htm>, поступающие в организм с пищей <http://www.tryphonov.ru/tryphonov2/terms2/food.htm> (углеводы <http://www.tryphonov.ru/tryphonov5/terms5/carbs.htm>, липиды <http://www.tryphonov.ru/tryphonov5/terms5/lipid.htm>, белки <http://www.tryphonov.ru/tryphonov5/terms5/prote.htm>). Значительная часть энергии, образующейся в процессе окисления питательных веществ, запасается в универсальном носителе энергии — молекулах нуклеотида <http://www.tryphonov.ru/tryphonov5/terms5/nuctid.htm>, называемого аденозинтрифосфатом <http://www.tryphonov.ru/tryphonov5/terms5/adtph.htm> (АТФ). Когда клетка для осуществления процессов жизни <http://www.tryphonov.ru/tryphonov6/terms6/life.htm>, в том числе и для осуществления внешнего дыхания <http://www.tryphonov.ru/tryphonov2/terms2/exresp.htm>, нуждается в энергии, единственное, что требуется для её получения — гидролиз <http://www.tryphonov.ru/tryphonov5/terms5/hydrl.htm> АТФ. Таким образом, АТФ — это связующее звено между клеточным дыханием и процессами жизнедеятельности <http://www.tryphonov.ru/tryphonov6/terms6/life.htm>, требующими затрат энергии.

Реакции окисления в клетке могут осуществляться как с участием кислорода, так и без участия кислорода. Если окисление питательных веществ осуществляется с участием кислорода, его называют аэробным клеточным дыханием. Если окисление питательных веществ осуществляется без участия кислорода (окисление одного субстрата за счет восстановления другого), то его называют анаэробным клеточным дыханием.

Литература

1.      Биология. Пособие для поступающих в вузы / А.Г. Мустафин, Ф.К. Лагнуев, Н.Г. Быстренина и др., под ред.В.Н. Ярыгина. — М.: Высшая школа, 2008. — 492 с.

2.      Биология. Справочник школьника и студента / Под ред.З. Брема, И. Мейнке. — М.: Дрофа, 2009. — 400 с.

.        Грин Н., Стаут У., Тейлор Д. Биология / Н. Грин, У. Стаут, Д. Тейлор, под ред.Р. Сопера. — М.: Мир, 2007. — Т.1. — 368 с.

.        Кемп П., Армс К. Введение в биологию / П. Кемп, К. Армс. — М.: Мир, 2008. — 671 с.

.        Пехов А.П. Биология с основами экологии. Учебное пособие для вузов с грифом МО / А.П. Пехов. — СПб.: Изд-во «Лань», 2007. — 672 с.


Скачать архив (8.0 Kb)

Схожие материалы:

Карта сайта

Страница не найдена. Возможно, карта сайта Вам поможет.

  • Главная
  • Университет
    • Об университете
    • Структура
    • Нормативные документы и процедуры
    • Лечебная деятельность
    • Международное сотрудничество
    • Пресс-центр
      • Новости
      • Анонсы
      • События
      • Объявления и поздравления
      • Online конференции
      • Фотоальбом
        • Республиканская онлайн-конференция, посвященная 60-летию кафедры акушерства и гинекологии
        • Alma Mater-2021 (ПФ, МДФ)
        • В ГрГМУ вручили сертификаты слушателям школы резерва кадров
        • Оториноларингологические чтения
        • Alma Mater-2021 (ЛФ, МПФ)
        • Диалоговая площадка с депутатом Палаты представителей Олегом Сергеевичем Гайдукевичем
        • Визит экспертной группы бизнес-премии «Лидер года»
        • Заместитель премьер-министра Республики Беларусь Игорь Викторович Петришенко встретился со студентами ГрГМУ
        • Делегация Багдадского университета с визитом в ГрГМУ
        • Студенческий фестиваль национальных культур-2021
        • Студент года-2021
        • Занятия в симуляционном центре ГрГМУ, имитирующем «красную зону»
        • Торжественная церемония вручения дипломов о переподготовке
        • Праздничный концерт, посвященный Дню Матери
        • Церемония подписания договора о сотрудничестве вуза и Гродненской православной епархии
        • Диалоговая площадка с председателем Гродненского облисполкома Владимиром Степановичем Караником
        • Выставка-презентация учреждений высшего образования «Образование будущего»
        • Товарищеский турнир по мини-футболу
        • Конференция «Современные проблемы радиационной и экологической медицины, лучевой диагностики и терапии»
        • Посвящение в первокурсники-2021
        • Встреча заместителя министра здравоохранения Д.В. Чередниченко со студентами
        • Открытый диалог, приуроченный к 19-летию БРСМ
        • Группа переподготовки по специальности «Организация здравоохранения»
        • Собрания факультетов для первокурсников-2021
        • День знаний — 2021
        • Совет университета
        • Студенты военной кафедры ГрГМУ приняли присягу
        • День освобождения Гродно-2021
        • Ремонтные и отделочные работы
        • Итоговая практика по военной подготовке
        • День Независимости-2021
        • Студенты военной кафедры ГрГМУ: итоговая практика-2021
        • Выпускной лечебного факультета-2021
        • Выпускной медико-психологического и медико-диагностического факультетов-2021
        • Выпускной педиатрического факультета-2021
        • Выпускной факультета иностранных учащихся-2021
        • Вручение дипломов выпускникам-2021
        • Митинг-реквием, посвященный 80-й годовщине начала Великой Отечественной войны
        • Акция «Память», приуроченная к 80-летию начала Великой Отечественной войны
        • Республиканский легкоатлетический студенческий забег «На старт, молодежь!»
        • Актуальные вопросы гигиены питания
        • Торжественное мероприятие к Дню медицинских работников-2021
        • Совет университета
        • Выездное заседание Республиканского совета ректоров
        • Церемония вручения медалей и аттестатов особого образца выпускникам 2021 года
        • Предупреждение деструктивных проявлений в студенческой среде и влияния агрессивного информационного контента сети интернет
        • Онлайн-выставка «Помнить, чтобы не повторить»
        • Областная межвузовская конференция «Подвиг народа бессмертен»
        • Финал первого Республиканского интеллектуального турнира ScienceQuiz
        • Конференция «Актуальные вопросы коморбидности заболеваний в амбулаторной практике: от профилактики до лечения»
        • День семьи-2021
        • Диалоговая площадка с председателем Гродненского областного Совета депутатов
        • Праздничные городские мероприятия к Дню Победы
        • Областной этап конкурса «Королева студенчества-2021″
        • Праздничный концерт к 9 мая 2021
        • IV Республиканский гражданско-патриотический марафон «Вместе – за сильную и процветающую Беларусь!»
        • Университетский кубок КВН-2021
        • Музыкальная планета студенчества (завершение Дней ФИУ-2021)
        • Молодёжный круглый стол «Мы разные, но мы вместе»
        • Дни ФИУ-2021. Интеллектуальная игра «Что?Где?Когда?»
        • Неделя донорства в ГрГМУ
        • Творческая гостиная. Дни ФИУ-2021
        • Открытие XVIII студенческого фестиваля национальных культур
        • Передвижная мультимедийная выставка «Партизаны Беларуси»
        • Республиканский субботник-2021
        • Семинар «Человек внутри себя»
        • Международный конкурс «Здоровый образ жизни глазами разных поколений»
        • Вручение нагрудного знака «Жена пограничника»
        • Встреча с представителями медуниверситета г. Люблина
        • Королева Студенчества ГрГМУ — 2021
        • День открытых дверей-2021
        • Управление личными финансами (встреча с представителями «БПС-Сбербанк»)
        • Весенний «Мелотрек»
        • Праздничный концерт к 8 Марта
        • Диалоговая площадка с председателем Гродненского облисполкома
        • Расширенное заседание совета университета
        • Гродно — Молодежная столица Республики Беларусь-2021
        • Торжественное собрание, приуроченное к Дню защитника Отечества
        • Вручение свидетельства действительного члена Белорусской торгово-промышленной палаты
        • Новогодний ScienceQuiz
        • Финал IV Турнира трех вузов ScienseQuiz
        • Областной этап конкурса «Студент года-2020″
        • Семинар дистанционного обучения для сотрудников университетов из Беларуси «Обеспечение качества медицинского образования и образования в области общественного здоровья и здравоохранения»
        • Студент года — 2020
        • День Знаний — 2020
        • Церемония награждения лауреатов Премии Правительства в области качества
        • Военная присяга
        • Выпускной лечебного факультета-2020
        • Выпускной медико-психологического факультета-2020
        • Выпускной педиатрического факультета-2020
        • Выпускной факультета иностранных учащихся-2020
        • Распределение — 2020
        • Стоп коронавирус!
        • Навстречу весне — 2020
        • Профориентация — 18-я Международная специализированная выставка «Образование и карьера»
        • Спартакиада среди сотрудников «Здоровье-2020″
        • Конференция «Актуальные проблемы медицины»
        • Открытие общежития №4
        • Встреча Президента Беларуси со студентами и преподавателями медвузов
        • Новогодний утренник в ГрГМУ
        • XIX Республиканская студенческая конференция «Язык. Общество. Медицина»
        • Alma mater – любовь с первого курса
        • Актуальные вопросы коморбидности сердечно-сосудистых и костно-мышечных заболеваний в амбулаторной практике
        • Областной этап «Студент года-2019″
        • Финал Science Qiuz
        • Конференция «Актуальные проблемы психологии личности и социального взаимодействия»
        • Посвящение в студенты ФИУ
        • День Матери
        • День открытых дверей — 2019
        • Визит в Азербайджанский медицинский университет
        • Семинар-тренинг с международным участием «Современные аспекты сестринского образования»
        • Осенний легкоатлетический кросс — 2019
        • 40 лет педиатрическому факультету
        • День Знаний — 2019
        • Посвящение в первокурсники
        • Акция к Всемирному дню предотвращения суицида
        • Турслет-2019
        • Договор о создании филиала кафедры общей хирургии на базе Брестской областной больницы
        • День Независимости
        • Конференция «Современные технологии диагностики, терапии и реабилитации в пульмонологии»
        • Выпускной медико-диагностического, педиатрического факультетов и факультета иностранных учащихся — 2019
        • Выпускной медико-психологического факультета — 2019
        • Выпускной лечебного факультета — 2019
        • В добрый путь, выпускники!
        • Распределение по профилям субординатуры
        • Государственные экзамены
        • Интеллектуальная игра «Что? Где? Когда?»
        • Мистер и Мисс факультета иностранных учащихся-2019
        • День Победы
        • IV Республиканская студенческая военно-научная конференция «Этих дней не смолкнет слава»
        • Республиканский гражданско-патриотический марафон «Вместе — за сильную и процветающую Беларусь!»
        • Литературно-художественный марафон «На хвалях спадчыны маёй»
        • День открытых дверей-2019
        • Их имена останутся в наших сердцах
        • Областной этап конкурса «Королева Весна — 2019″
        • Королева Весна ГрГМУ — 2019
        • Профориентация «Абитуриент – 2019» (г. Барановичи)
        • Мероприятие «Карьера начинается с образования!» (г. Лида)
        • Итоговое распределение выпускников — 2019
        • «Навстречу весне — 2019″
        • Торжественная церемония, посвященная Дню защитника Отечества
        • Торжественное собрание к Дню защитника Отечества — 2019
        • Мистер ГрГМУ — 2019
        • Предварительное распределение выпускников 2019 года
        • Митинг-реквием у памятника воинам-интернационалистам
        • Профориентация «Образование и карьера» (г.Минск)
        • Итоговая коллегия главного управления здравоохранения Гродненского областного исполнительного комитета
        • Спартакиада «Здоровье — 2019»
        • Итоговая научно-практическая конференция «Актуальные проблемы медицины».
        • Расширенное заседание Совета университета.
        • Научно-практическая конференция «Симуляционные технологии обучения в подготовке медицинских работников: актуальность, проблемные вопросы внедрения и перспективы»
        • Конкурс первокурсников «Аlma mater – любовь с первого курса»
        • XVI съезд хирургов Республики Беларусь
        • Итоговая практика
        • Конкурс «Студент года-2018»
        • Совет университета
        • 1-й съезд Евразийской Аритмологической Ассоциации (14.09.2018 г.)
        • 1-й съезд Евразийской Аритмологической Ассоциации (13.09.2018 г.)
        • День знаний
        • День независимости Республики Беларусь
        • Церемония награждения победителей конкурса на соискание Премии СНГ
        • День герба и флага Республики Беларусь
        • «Стань донором – подари возможность жить»
        • VIII Международный межвузовский фестиваль современного танца «Сделай шаг вперед»
        • Конкурс грации и артистического мастерства «Королева Весна ГрГМУ – 2018»
        • Окончательное распределение выпускников 2018 года
        • Митинг-реквием, приуроченный к 75-летию хатынской трагедии
        • Областное совещание «Итоги работы терапевтической и кардиологической служб Гродненской области за 2017 год и задачи на 2018 год»
        • Конкурсное шоу-представление «Мистер ГрГМУ-2018»
        • Предварительное распределение выпускников 2018 года
        • Итоговая научно-практическая конференция «Актуальные проблемы медицины»
        • II Съезд учёных Республики Беларусь
        • Круглый стол факультета иностранных учащихся
        • «Молодежь мира: самобытность, солидарность, сотрудничество»
        • Заседание выездной сессии Гродненского областного Совета депутатов
        • Областной этап республиканского конкурса «Студент года-2017»
        • Встреча с председателем РОО «Белая Русь» Александром Михайловичем Радьковым
        • Конференция «Актуальные вопросы инфекционной патологии», 27.10.2017
        • XIX Всемирный фестиваль студентов и молодежи
        • Республиканская научно-практическая конференция «II Гродненские аритмологические чтения»
        • Областная научно-практическая конференция «V Гродненские гастроэнтерологические чтения»
        • Праздник, посвящённый 889-летию города Гродно
        • Круглый стол на тему «Место и роль РОО «Белая Русь» в политической системе Республики Беларусь» (22.09.2017)
        • ГрГМУ и Университет медицины и фармации (г.Тыргу-Муреш, Румыния) подписали Соглашение о сотрудничестве
        • 1 сентября — День знаний
        • Итоговая практика на кафедре военной и экстремальной медицины
        • Квалификационный экзамен у врачей-интернов
        • Встреча с Комиссией по присуждению Премии Правительства Республики Беларусь
        • Научно-практическая конференция «Амбулаторная терапия и хирургия заболеваний ЛОР-органов и сопряженной патологии других органов и систем»
        • День государственного флага и герба
        • 9 мая
        • Республиканская научно-практическая конференция с международным участием «V белорусско-польская дерматологическая конференция: дерматология без границ»
        • «Стань донором – подари возможность жить»
        • «Круглый стол» Постоянной комиссии Совета Республики Беларусь Национального собрания Республики Беларусь по образованию, науке, культуре и социальному развитию
        • Весенний кубок КВН «Юмор–это наука»
        • Мисс ГрГМУ-2017
        • Распределение 2017 года
        • Общегородской профориентационный день для учащихся гимназий, лицеев и школ
        • Праздничный концерт, посвященный Дню 8 марта
        • Конкурсное шоу-представление «Мистер ГрГМУ–2017»
        • «Масленица-2017»
        • Торжественное собрание и паздничный концерт, посвященный Дню защитника Отечества
        • Лекция профессора, д.м.н. О.О. Руммо
        • Итоговая научно-практическая конференция «Актуальные проблемы медицины»
        • Меморандум о сотрудничестве между областной организацией Белорусского общества Красного Креста и региональной организацией Красного Креста китайской провинции Хэнань
        • Визит делегации МГЭУ им. А.Д. Сахарова БГУ в ГрГМУ
        • «Студент года-2016»
        • Визит Чрезвычайного и Полномочного Посла Королевства Швеция в Республике Беларусь господина Мартина Оберга в ГрГМУ
        • Конкурс первокурсников «Аlma mater – любовь с первого курса»
        • День матери в ГрГМУ
        • Итоговая практика-2016
        • День знаний
        • Визит китайской делегации в ГрГМУ
        • Визит иностранной делегации из Вроцлавского медицинского университета (Республика Польша)
        • Торжественное мероприятие, посвященное профессиональному празднику – Дню медицинского работника
        • Визит ректора ГрГМУ Виктора Александровича Снежицкого в Индию
        • Республиканская университетская суббота-2016
        • Республиканская акция «Беларусь против табака»
        • Встреча с поэтессой Яниной Бокий
        • 9 мая — День Победы
        • Митинг, посвященный Дню Государственного герба и Государственного флага Республики Беларусь
        • Областная межвузовская студенческая научно-практическая конференция «1941 год: трагедия, героизм, память»
        • «Цветы Великой Победы»
        • Концерт народного ансамбля польской песни и танца «Хабры»
        • Суботнiк ў Мураванцы
        • «Мисс ГрГМУ-2016»
        • Визит академика РАМН, профессора Разумова Александра Николаевича в УО «ГрГМУ»
        • Визит иностранной делегации из Медицинского совета Мальдивской Республики
        • «Кубок ректора Гродненского государственного медицинского университета по дзюдо»
        • «Кубок Дружбы-2016» по мини-футболу среди мужских и женских команд медицинских учреждений образования Республики Беларусь
        • Распределение выпускников 2016 года
        • Визит Министра обороны Республики Беларусь на военную кафедру ГрГМУ
        • Визит Первого секретаря Посольства Израиля Анны Кейнан и директора Израильского культурного центра при Посольстве Израиля Рей Кейнан
        • Визит иностранной делегации из провинции Ганьсу Китайской Народной Республики в ГрГМУ
        • Состоялось открытие фотовыставки «По следам Библии»
        • «Кубок декана» медико-диагностического факультета по скалолазанию
        • Мистер ГрГМУ-2016
        • Приём Первого секретаря Посольства Израиля Анны Кейнан в ГрГМУ
        • Спартакиада «Здоровье» УО «ГрГМУ» среди сотрудников 2015-2016 учебного года
        • Визит Посла Республики Индия в УО «ГрГМУ»
        • Торжественное собрание и концерт, посвященный Дню защитника Отечества
        • Митинг-реквием, посвященный Дню памяти воинов-интернационалистов
        • Итоговое заседание коллегии главного управления идеологической работы, культуры и по делам молодежи Гродненского облисполкома
        • Итоговая научно-практическая конференция Гродненского государственного медицинского университета
        • Новогодний концерт
        • Открытие профессорского консультативного центра
        • Концерт-акция «Молодёжь против СПИДа»
        • «Студент года-2015»
        • Открытые лекции профессора, академика НАН Беларуси Островского Юрия Петровича
        • «Аlma mater – любовь с первого курса»
        • Открытая лекция Регионального директора ВОЗ госпожи Жужанны Якаб
        • «Открытый Кубок по велоориентированию РЦФВиС»
        • Совместное заседание Советов университетов г. Гродно
        • Встреча с Министром здравоохранения Республики Беларусь В.И. Жарко
        • День города
        • Дебаты «Врач — выбор жизни»
        • День города
        • Праздничный концерт «Для вас, первокурсники!»
        • Акция «Наш год – наш выбор»
        • День знаний
        • Открытое зачисление абитуриентов в УО «Гродненский государственный медицинский университет»
        • Принятие военной присяги студентами ГрГМУ
        • День Независимости Республики Беларусь
        • Вручение дипломов выпускникам 2015 года
        • Республиканская олимпиада студентов по педиатрии
        • Открытие памятного знака в честь погибших защитников
        • 9 мая
        • «Вторая белорусско-польская дерматологическая конференция: дерматология без границ»
        • Мистер университет
        • Мисс универитет
        • КВН
        • Гродненский государственный медицинский университет
        • Чествование наших ветеранов
        • 1 Мая
        • Cовместный субботник
      • Наши издания
      • Медицинский календарь
      • Университет в СМИ
      • Видео-презентации
    • Общественные объединения
    • Комиссия по противодействию коррупции
    • Образовательная деятельность
  • Абитуриентам
  • Студентам
  • Выпускникам
  • Слайдер
  • Последние обновления
  • Баннеры
  • Иностранному гражданину
  • Научная деятельность
  • Поиск

7. Свойства и биологические функции белков

7

СВОЙСТВА И БИОЛОГИЧЕСКИЕ ФУНКЦИИ БЕЛКОВ

К белкам относятся такие вещества живых организмов, как альбумин (яичный белок), инсулин — гормон поджелудочной железы, трипсин и лизоцим — ферменты пищеварительной системы. Они обладают специфическими особенностями и выполняют в клетке различные функции.
Почему белки играют такую большую роль в жизни живых существ?
Почему понятие“белок” отождествляют с понятием “жизнь”?

Деятельность

Лабораторная работа

Изучение процесса денатурации белков.
Оборудование: пробирки с яичным белком и молоком, уксусная кислота, спиртовка, пипетка.
Ход работы:
1. В одну пробирку налейте 10-15 мл раствора яичного белка и нагрейте в пламени горелки.
2. Добавьте в другую пробирку с молоком несколько капель уксусной кислоты.

– Что вы наблюдаете?
– Какой вывод можно сделать из проведенного исследования?

Свойства белков. Под влиянием различных физических и химических факторов (воздействие спирта, кислот, щелочей, высокой температуры, радиации и др.) молекула белка теряет свои свойства, и спираль начинает раскручиваться. Процесс нарушения природной структуры белка называется денатурацией (от лат. “” — отсутствие, лишать чего-либо,“natura” — природа). Денатурация может быть обратимой и необратимой.

При денатурации вначале нарушается четвертичная, далее третичная и, наконец, вторичная структура белка. Если в результате какого-либо фактора нарушается первичная структура белка, то денатурация становится необратимой. К примеру, яичный белок подвергается денатурации при 60-70°С. Если первичная структура белка не нарушена, то молекула способна, скручиваясь вернуться в свое первоначальное природное состояние. Это явление называется обратимой денатурацией, или ренатурацией. Это означает, что все особенности строения и функций белковой молекулы определяются ее первичной структурой.  

Функции белков. Ряд белков, играя в клетке роль биологических катализаторов, ускоряют скорость химических реакций и регулируют процессы, происходящие в ней. Такие белки называются ферментами. Ферменты также участвуют в таких процессах, как транспортировка молекул, расщепление и синтез белков, жиров и углеводов и т.д. В живой клетке ни одна реакция не может происходить без участия ферментов.

Ключевые слова

• денатурация
• ренатурация
• фермент
Помимо ферментативной (каталитической) функции, белки в клетке выполняют ряд таких функций, как строительная, транспортная, защитная, двигательная и т.д. При полном расщеплении 1г белка высвобождается 17,6 кДж энергии.
  • При стрессе организм испытывает необходимость в определенных аминокислотах. Если нужные аминокислоты отсутствуют, то нарушается иммунитет.
  • В организме человека белком, имеющим самую длинную аминокислотную цепь, является титин. Его длина составляет 38138 аминокислот.
  • В течение 5-6 месяцев большинство белков в организме человека заменяются новыми.
  • Кровь осьминогов и других моллюсков, пауков имеет голубоватый оттенок, потому что содержит не гемоглобин, придающий крови красный цвет и содержающий железо, а гемоциан, содержащий атомы меди.

ПРИМЕНЕНИЕ И ПРОВЕРКА ПОЛУЧЕННЫХ ЗНАНИЙ

1. Завершите схему:2. Почему денатурация бывает обратимой и необратимой? 
3. Опишите процессы, происходящие в организме, используя предложенные понятия.

Полимер, фермент, аминокислота, гемоглобин

4. Ответьте на вопросы:
  • Шерсть содержит белок кератин. Почему шерстяные изделия садятся при стирке в воде с температурой 90-100 С° ?
  • При окислении 1г белков выделяется столько же энергии, сколько при окислении 1г углеводов. Почему же организм использует белки как источник энергии только в крайнем случае?
  • Особые белки, называемые антителами, уничтожают чужеродные частицы, попавшие в организм. Какую функцию белков демонстрирует этот пример?

e

«Свойства и функции белков». 10-й класс

Категория: Биология.

Тип урока: изучение нового материала.

Цели:

  • расширить и углубить понятия о структуре белка;
  • познакомить учащихся с основными свойствами и функциями белка;
  • развивать умения работать с текстом, делать выводы,  применять полученные знания на практике, работать в группе;
  • воспитывать чувство товарищества, культуру речи, аккуратность.

ХОД УРОКА

1. Вступление. Оргмомент

Урок начинается со стихов Семёна Яковлевича Надсона:

 «Меняя каждый шаг свой образ прихотливый
Капризна как дитя и призрачна как дым,
Кипит повсюду жизнь в тревоге суетливой,
великое смешав с ничтожным и смешным…»

Учитель: Эти строки позволяют задуматься над вопросом, который всегда волновал людей:  «Что такое жизнь?» В течение веков копились наблюдения, проводились исследования, создавались теории. Они послужили основой новых исследований, другие – гибли ввиду несостоятельности.
Наука XIX в. ещё не могла видеть всей глубины изучаемого вопроса, но накопила достаточно экспериментального материала, чтобы дать следующее определение жизни: «Жизнь есть способ существования белковых тел. Существенным моментом которого является постоянный обмен веществ с окружающей их внешней природой…»

– Выделите ключевые слова в этой части определения.

(После того, как ученики выделят  ключевые слова, учитель проговаривает вторую часть определения).

«… Причём с прекращением этого обмена веществ прекращается и сама жизнь, что приводит к разложению белка».

Определение жизни данное Ф. Энгельсом в работе «Антидюринг» позволяет задуматься над вопросом «Как современная наука представляет процесс жизни?» Ответ следующий : «Жизнь – переплетение сложных химических процессов взаимодействия белков между собой и другими веществами.
Сегодня мы предлагаем вам проследовать по стопам развивающейся науки и прежде всего раскрыть тайну веществ, лежащих в основе жизни, т.е. выяснить что такое белок?

2. Актуализация знаний

Цель: расширить и углубить знания о структуре и основных свойствах белка и познакомиться с составом и строением белков.

а) Первичная структура белка. (На рисунке изображена первичная структура белка).

– Какие функциональные группы входят в состав АК?
– Какие свойства они определяют ?
– Из дипептида получите трипептид, возьмите формулу цистеина или серина.

б) Вторичная структура белка.

– Какова пространственная конфигурация  вторичной структуры ?
– Благодаря чему молекула белка закручивает и удерживает данную структуру?
– Чем отличается данный уровень организации белка от первичного? В чём его необходимость?

в) Третичная структура белка.

– Какова пространственная конфигурация третичной структуры ?
– Благодаря чему молекула белка закручивается в клубок и удерживает данную структуру?
– Чем отличается данный уровень организации от первоначальных?
– В чём заключается его роль?

Учитель: таким образом, белки – это внешняя саморегулирующаяся форма развития веществ, в которой первичная структура опосредованно определяет его биологическую активность.

3. Изучение нового материала

3.1. Свойства белков

Учитель биологии: При изменении структуры молекулы белка меняются его физические свойства, а это имеет большое значение для биологических процессов (движения, сокращения, деления клеток). Например, мышечные белки (миозин и актин) обладают разными физико – химическими свойствами, но при сокращении мышцы эти белки образуют единый комплекс.

– Каковы же физико-химические свойства белков? (Учитель знакомит учащихся с основными свойствами белка)

а) растворимость в воде
б) образование осадка
в) цветные реакции

(Учащиеся по мере изучения нового материала проводят опыты)

3.2. Функции белков

Учитель: (даёт познавательную задачу)
Известно, что белки – неотъемлемая часть пищи животных и человека. Почему же при исключении из рациона белкового компонента, но при достаточной калорийности пищи у живых организмов наблюдаются патологические явления: остановка роста, изменение состава крови и т.д.? С чем это связано?
Чтобы ответить на этот вопрос вы должны познакомиться с функциями белков.

(Самостоятельная работа учащихся с текстом учебника и учебным текстом. По мере работы они заполняют в тетради таблицу «Функции белков».)

Вопросы для проверки знаний по данному вопросу (фронтальная беседа)

1 уровень:

  • Какие функции выполняют белки?
  • В чём заключается строительная функция белков?
  • В чём заключается каталитическая функция белков?
  • В чём заключается сигнальная функция белков?
  • В чём заключается двигательная функция белков?
  • В чём заключается транспортная функция белков?
  • В чём заключается защитная функция белков?
  • В чём заключается энергетическая функция белков?
  • Что общего в названии групп ферментов?

2 уровень:

  • Какие белки являются регуляторами физиологических процессов?
  • Какую болезнь вызывает недостаток инсулина у человека?
  • Могут ли гормоны оказать негативное влияние на организм?
  • Какую транспортную функцию выполняет сложный белок гемоглобин? Где он находится в организме?
  • Миллионы человеческих жизней были спасены от оспы, бешенства и других болезней.
  • Каким образом медицина предупреждает названные инфекционные болезни?

Учитель: Действительно, функции белков очень разнообразны, но одной из самых главных функций является ферментативная.
Все ферменты содержат в своём составе белки, поэтому биохимические реакции находятся под контролем белков.

Сообщение ученика: Академик И.П. Павлов назвал ферменты « возбудителями жизни и нервным актом жизненной деятельности». Учение о ферментах выделяют в самостоятельную науку – энзимологию. Известно, что все ферменты имеют белковую природу, но далеко не все белки обладают ферментативными свойствами. Термин « фермент» с латинского языка переводится как «закваска», «энзим» означает «в дрожжах».

Учитель: А сейчас каждая группа проведёт лабораторный эксперимент,  доказывающий каталитическую активность ферментов в живых тканях и потом доложат о результатах своего исследования.

1 группа: на кусочек вареного и сырого мяса капнуть пероксид водорода. Описать наблюдаемое явление.

Сделать вывод : как проявляется активность ферментов в  живых и мертвых тканях?

2 группа: взять один целый кусочек сырого картофеля, а второй измельчённый , капнуть пероксид водорода. Что наблюдается ?

Сделать вывод : как проявляется активность ферментов  в измельчённых тканях?

3 группа: на лист элодея капнуть пероксид водорода. Описать наблюдаемое явление.
Капните пероксид водорода на чистое стекло.

Сделать вывод: почему на листе элодея выделяются пузырьки газа, а на чистом стекле нет?

Учитель: На основании всего выше изложенного  можно сделать вывод о том, что белки – обязательный компонент всех клеточных структур. Белки – совершенно исключительные вещества, без которых не может обойтись ни одно живое существо планеты. Их сложность и многообразие форм позволяет создавать все существующие разнообразия форм жизни, неповторимость организмов как в прошлом, так и в будущем.

4. Закрепление материала

Учитель: С целью коррекции и отработки понятийного аппарата проводится логический брифинг. Каждая команда получает карточки, на которых записаны ответы на вопросы, после зачитывания вопроса команды поднимают карточку с правильным ответом и получает за правильный ответ жетон.

4.1. Задачи для логического брифинга:

  • Научное название белков. (Протеины)
  • Группы атомов, обслуживающие амфотерные свойства АК. (Амино- и карбоксильная группа)
  • Связь, соединяющая аминокислотные остатки и полимерную цепь. (Пептидная и амидная связь)
  • Мономеры, составляющие основу первичной структуры белка. (Аминокислоты)
  • Структура белка, свёрнутая в спираль. (Вторичная)
  • Конфигурация третичной структуры белка. (Глобула, фибрилла)
  • Группа атомов, обусловливающая биологическую активность усложнённых белковых структур. (Радикал)
  • Разрушение первичной структуры белка. (Гидролиз)
  • Процесс, обратный ренатурации. (Денатурация)
  • Реакции, определяющие наличие белка. (Биуретовая  и ксантопротеиновая)
  • Гормон поджелудочной железы. (Инсулин)
  • Пищевые продукты с высоким содержанием белка. (Яйца, молоко, рыба, мясо)

(Для определения реального уровня полученных знаний проводится тест с самопроверкой)

4.2. Тест

1 уровень:

В-1

1. Выберите схему, соответствующую первичной структуре белка.

2. Определи термин, не подходящий по смыслу «полимер»

  • Нуклеотид
  • Мономер
  • Дипептид

3. Процесс утраты белковой молекулой своей структурной организации:

  • Гидролиз
  • Коагуляция
  • Ренатурация

В-2

1. Каких составных частей не достаёт в формуле АК?

2. В данной цепочке функциональных групп есть одна лишняя, определяющая иные свойства. Найди её.

3. Процесс восстановления структурной организации белков молекулы:

  • гидролиз
  • денатурация
  • ренатурация

2 уровень:

В-1

1. Какие структуры реализуют биологическую активность белка?

  • Радикалы
  • Полипептид
  • Химические связи

2. В образовании какой структуры принимает участие дисульфидные мостики?

  • Вторичной
  • Первичной
  • Третичной

3. Пользуясь таблицей незаменимых аминокислот составьте дипептид из глицина и аланина.

В-2

1. Какой уровень организации опосредованно определяет биологическую активность белка?

  • Третичная
  • Первичная
  • Вторичная

2. При денатурации происходит разрушение структуры:

  • Вторичной
  • Первичной
  • Третичной

3. Пользуясь таблицей незаменимых аминокислот составьте дипептид цитезина и серина и назовите его.

(Подводится итог и подсчёт красных и оранжевых жетонов).

5. Заключение

Учитель: Человеку всегда хотелось чуда. Одним из чудес остаётся возникновение жизни, превращение неживой материи в живой организм. Данное учебное занятие даёт возможность «приоткрыть дверь» научного познания и понять, что жизнь и белки неразрывно связаны.

Учитель химии: Чтобы ответить на вопрос, что такое жизнь, надо ответить , что такое белки? Насколько многообразен белок, настолько сложна, загадочна и многолика сама жизнь. Подтверждение этому высказывание Гете о том, что мир не мог существовать, если бы так просто устроен.

Стих С. Я. Надсона (читает ученик)

Вот жизнь, что сфинкс! Закон ее – мгновенье,
И нет среди людей такого мудреца,
Кто мог сказать толпе, куда ее движенье,
Кто мог бы уловить черты ее лица,
То вся она – печаль, то вся она приманка,
То все в ней блеск и свет, то все позор и тьма,
Жизнь – это Серафим и пьяная Вакханка,
Жизнь – это океан и тесная тюрьма.

26.05.2014

Строение, свойства и функции белков

Строение, свойства и функции белков

Простые и сложные белки

Белки — это высокомолекулярные органические вещества, молекулы которых построены из остатков α-аминокислот, связанных между собой пептидными связями. Живая природа характеризуется рядом свойств, отличающих её от неживой природы, и все эти свойства связаны с белками. Белки выполняют множество разнообразных функций, характерных для живых организмов.

Рассмотрим главные функции, некоторые из которых являются уникальными:

Структурная функция. Белки выполняющие структурную (опорную) функцию, занимают по количеству первое место среди других белков тела человека. Это коллаген и эластин соединительной ткани, кератин в коже, волосах, ногтях, миозин и тропомиозин в мышцах. В  комплексе с липидами белки входят в состав биомембран клеток.

Каталитическая функция. В настоящие время известно более 3400 ферментов, называемых биологическими катализаторами и все они являются белками. Например: амилаза слюны, сахараза кишечного сока и др.

Транспортная функция. Дыхательная функция крови, в частности перенос кислорода и углекислоты, осуществляется гемоглобином. В транспорте липидов участвуют  альбумины сыворотки крови, железа- трансферрин.

Защитная функция. Эту функцию  в организме выполняет иммунная система, которая обеспечивает синтез специфических защитных белков-антител в ответ на внедрение в организм бактерий, токсинов, вирусов или чужеродных соединений. Защитная функция белков проявляется и в способности фибриногена плазмы крови к свёртыванию, в результате образуется сгусток крови, предохраняющий от потери крови при ранениях.

Сократительная функция. В процессе мышечного сокращения и расслабления главную роль играют актин и миозин- специфические белки мышц.

Гормональная функция. Обмен веществ и физиологические функции  в организме регулируются гормонами, многие из которых представлены белками, пептидами и производными аминокислот. Например: инсулин, гормон роста, глюкагон и адреналин.

Питательная (резервная) функция. Эту функцию выполняют белки, являющиеся источниками питания: это казеин молока, овальбумин яйца.

Содержание белков в органах и тканях

Большинство белков хорошо растворимы в воде. Белки, выделенные из хряща, волос, ногтей, костей нерастворимы в воде. В мышцах, лёгких, селезёнке, почках на долю белков приходится 70-80%, а во всём теле человека -45% от сухой массы (табл.1).

Таблица 1. Содержание белков в органах и тканях

       Органы и ткани

        Содержание белков в  %

От массы

сухой ткани

От общего

 белка тела

Кожа

63

11,5

Кости (твердые ткани)

20

18,7

Зубы (твердые ткани)

18

0,1

Поперечно- полосатые мышцы

80

34,7

Мозг и нервная ткань

45

2,0

Печень

57

3,6

Сердце

60

0,7

Легкие

82

3,7

Селезенка

84

0,2

Продолжение табл.1              

       Органы и ткани

        Содержание белков в  %

От массы

сухой ткани

От общего

 белка тела

Почки

72

0,5

Поджелудочная железа

47

0,1

Пищеварительный тракт

63

1,8

Жировая ткань

14

6,4

Остальные ткани:

жидкие

плотные

85

54

1,4

14,6

Все тело

45

100

Функции, структура, свойства и классификация

Давайте углубимся в изучение белков. Прочитав эту статью, вы узнаете о: 1. функциях белков 2. структурах белков 3. свойствах белков и 4. классификации белков.

Белки — это азотистые органические соединения с высокой молекулярной массой, которые играют жизненно важную или первостепенную роль в живых организмах. Они состоят из 20 стандартных α-аминокислот.

Функции белков:

Основными функциями белков в организме человека являются:

1. Они служат единицами построения тела, например, мышечными белками.

2. Они обеспечивают поддержку и защиту различных тканей, например, коллагена и кератина.

3. Все химические реакции в организме катализируются белковыми ферментами, например трипсином.

4. Они переносят различные молекулы и ионы от одного органа к другому, например.г., гемоглобин, сывороточный альбумин.

5. Они хранят и обеспечивают питательные вещества, например, казеин молока, яичный альбумин.

6. Они защищают организм от вредных чужеродных организмов, например, иммуноглобулина, фибриногена.

7. Они помогают регулировать клеточную или физиологическую активность, например, гормоны, а именно, инсулин, GH.

Структуры белков:
Первичная структура белков :

Первичная структура белков относится к общему количеству аминокислот и их последовательности в данном конкретном белке.

Фиксированное количество аминокислот расположено в определенной последовательности. Последовательность аминокислот в белке определяет его биологическую роль. У разных белков разные последовательности. Следовательно, изучение общего числа и последовательности аминокислот в белке — это изучение его первичной структуры.

Первичная структура отличает нормальный белок от аномального. Нормальный гемоглобин взрослого человека (HbA) состоит из 2 α-цепей и 2 β-цепей. Каждая α-цепь содержит 141 аминокислоту, а каждая β-цепь содержит 146 аминокислот, расположенных в определенной последовательности.Любое изменение последовательности приводит к аномальному гемоглобину. Как и в серповидно-клеточном гемоглобине (HbS), аминокислота валин присутствует в 6-м положении Р-цепи вместо глутаминовой кислоты в нормальном гемоглобине.

Вторичная структура белков :

Это относится к скручиванию полипептидной цепи в спиральную форму.

Обнаружены три типа винтовых структур:

(а) Альфа спираль

(б) Бета плиссе и

(c) Реверс.

1. Альфа-спираль:

α означает, что первая, а описанная ниже структура была первой среди обнаруженных спиральных структур, поэтому известна как альфа (α) спираль.

Отличительными чертами этой структуры являются:

и. Здесь полипептид скручен или свернут, образуя правостороннюю спиральную структуру.

ii. Расстояние между каждым витком катушки 5,4 Å.

iii. Их 3.6 аминокислот на ход.

iv. Видно, что группы «R» выступают из спирали.

v. Имеются внутрицепочечные водородные связи, при которых водород группы -NH соединяется с кислородом группы -CO 4-й аминокислоты, стоящей за ним. Таким образом, каждая пептидная группа участвует в образовании водородных связей.

vi. Этот тип структуры встречается во многих белках в сочетании с другими структурами. Чистая а-спиральная структура наблюдается в протеине волос, то есть в кератине.

2.Бета плиссе:

β означает второе, а описанная ниже структура была вторым открытием после α спирали.

Основные особенности этой структуры:

и. Здесь цепочка не винтовая, а зигзагообразная.

ii. Расстояние между каждым витком — 7 Å.

iii. Полипептидные цепи расположены рядом в виде складок.

iv. Между цепями существует межцепочечная водородная связь, и каждая пептидная группа участвует в водородной связи.

Цепи антипараллельны друг другу.

3. Реверс:

Складывается в обратном направлении цепи.

Третичная структура белков :

Спиральная форма полипептида складывается в сферическую, глобулярную, эллипсоидальную или другую конформацию, которая называется третичной структурой белков. Это сворачивание необходимо для биологической активности белков. например, ферменты, иммуноглобулины.

Третичная конформация поддерживается четырьмя типами облигаций:

1. Водородные связи:

Образуется между водородом и электроотрицательным атомом, таким как кислород или азот, в группе «R» аминокислот.

2. Ионные взаимодействия:

Образуется между кислотными (глутаминовая и аспарагиновая) и основными (аргинин, лизин или гистидин) аминокислотами.

3. Дисульфидные связи:

Это прочная связь, образованная между сульфагидрильными группами двух аминокислот цистеина.Образовавшаяся димерная структура известна как цистин (аминокислота, содержащаяся только в белках, а не в свободной форме).

4. Гидрофобные взаимодействия:

Группы «R» гидрофобных аминокислот объединяются вместе в центре вдали от воды, тем самым развивая силу притяжения между каждой группой «R» и силу отталкивания от воды, и эти взаимодействия известны как гидрофобные взаимодействия.

Четвертичная структура белков:

Четвертичная структура представлена ​​олигомерными белками.

Олигомерные белки:

— это те, которые имеют две или более полипептидных цепей.

Четвертичная структура относится к типу расположения полипептидов в олигомерном белке. Эти полипептиды удерживаются вместе водородными связями, ионными связями или силами Вандер-Ваальса, например, гемоглобин имеет четыре полипептидные цепи, которые расположены определенным образом, что относится к четвертичной структуре гемоглобина.

Четвертичная структура гемоглобина описывает, что он состоит из четырех полипептидных цепей; два из которых — α (α 1 и α 2 ), а два других — β (β 1 и β 2 ).Две альфа-цепи противоположны друг другу и примыкают к каждой -цепи. Цепи α и β связаны между собой солевыми мостиками.

Взаимосвязь структурных функций в белках:

Гемоглобин играет жизненно важную роль в транспортировке кислорода от легких к периферическим тканям и транспортировке углекислого газа из тканей в легкие.

Существует три типа нормального гемоглобина со следующими полипептидами:

(1) Гемоглобин взрослых (Hb A) имеет 2α2β цепи.

(2) Гемоглобин плода (Hb F) имеет 2α2γ цепи.

(3) Незначительный взрослый гемоглобин (Hb A 1 ) имеет 2α2δ цепи.

Число аминокислот в α-цепях составляет 141 аминокислоту, а в других цепях, т. Е. Β, γ и δ цепи содержат 146 аминокислот. Эти цепи различаются на основании разницы в последовательности расположения аминокислот в цепях. Четвертичная структура гемоглобина создает полость между тетрамером, в которой присутствует 2, 3, дифосфоглицерат (DPG или BPG), образующий солевой мостик с амино-концом β-цепи, который стабилизирует гемоглобин, тем самым снижая сродство к кислороду.

В легких парциальное давление кислорода высокое, что приводит к связыванию O 2 с одной из цепей Hb, тем самым разрывая солевые мостики между четырьмя субъединицами. Последующее связывание кислорода (сигмовидная кривая ассоциации Hb-O 9 ) облегчается за счет разрыва солевых мостиков, изменяющих вторичные, третичные и четвертичные структуры, что позволяет вращать одну субъединицу α / β относительно другой цепи α / β, тем самым сжимая тетрамер и выпуск ДПГ.Это приводит к увеличению его сродства к кислороду (R-состояние Hb).

В периферических тканях CO 2 связывается с a-аминогруппой аминоконца с его преобразованием с положительного заряда на отрицательный, что способствует образованию солевого мостика между полипептидными цепями с возвратом в дезокси-состояние (Т-состояние), т.е. высвобождение кислорода из Hb. Высвобождению O 2 из Hb также способствует связывание DPG с тетрамером.

Когда человек взлетает в полет, самолет медленно поднимается по высоте, что приводит к снижению напряжения O 2 , из-за чего оксигенация Hb невозможна.Таким образом, человек чувствует гипоксию, но физиологический механизм организма начинает снижать выработку DPG, благодаря чему Hb может связывать кислород даже при более низком давлении кислорода.

Таким образом, когда самолет достигает максимальной высоты и остается устойчивым, человек чувствует себя комфортно. Когда Hb достигает тканей, уровень DPG увеличивается, увеличивая выделение кислорода. Точно так же описанный выше процесс меняется на противоположный, когда человек ныряет глубоко в море. Высокое давление O 2 приводит к увеличению выработки DPG, способствуя оксигенации Hb в легких и дезоксигенированию периферических тканей.

Свойства белков:
1. Денатурация:

Частичное или полное разворачивание нативной (природной) конформации полипептидной цепи известно как денатурация. Это вызвано жарой, кислотами, щелочами, спиртом, ацетоном, мочевиной, бета-меркаптоэтанолом.

2. Коагуляция:

Когда белки денатурируются под действием тепла, они образуют нерастворимые агрегаты, известные как коагулят. Все белки не коагулируются при нагревании, только некоторые из них, такие как альбумины, глобулины способны коагулироваться при нагревании.

3. Изоэлектрический pH (pH 1 ):

pH, при котором белок имеет равное количество положительных и отрицательных зарядов, известен как изоэлектрический pH. Под воздействием электрического поля белки не перемещаются ни к аноду, ни к катоду, поэтому это свойство используется для выделения белков. Белки становятся наименее растворимыми при pH –1 и выпадают в осадок. PH казеина I равен 4,5, и при этом pH казеина в кислом молоке, образующем творог.

4. Молекулярная масса белков:

Средняя молекулярная масса аминокислоты принята равной 110. Общее количество аминокислот в белке, умноженное на 110, дает приблизительную молекулярную массу этого белка. Разные белки имеют разный аминокислотный состав и, следовательно, их молекулярные массы различаются. Молекулярные массы белков колеблются от 5000 до 10 9 Дальтон. Экспериментально молекулярную массу можно определить такими методами, как гель-фильтрация, PAGE, ультрацентрифугирование или измерения вязкости.

Классификация белков :

Белки классифицируются на основании:

(1) Их растворимость и

(2) Их структурная сложность.

A. Классификация по растворимости:

По растворимости в воде белки подразделяются на:

1. Волокнистые белки:

Нерастворимы в воде. В их состав входят структурные белки.У них есть поддерживающая функция (например, коллаген) и / или защитная функция (например, кератин и фибрин волос).

2. Глобулярные белки:

Они растворимы в воде. Они включают функциональные белки, например, ферменты, гемоглобин и т. Д.

B. Классификация на основе структурной сложности:

По сложности конструкции они делятся на:

(1) Простой

(2) Конъюгированные и

(3) Производные белки.

1. Простые белки:

Белки, состоящие только из аминокислот, известны как простые белки.

Далее они подразделяются на:

(а) Альбумины:

Они растворимы в воде, коагулируются при нагревании и осаждаются при полном насыщении сульфатом аммония, например, сывороточным альбумином, лактальбумином и яичным альбумином.

(б) Глобулины:

Они нерастворимы в воде, но растворимы в разбавленных солевых растворах.Они коагулируются при нагревании и осаждаются при полунасыщении сульфатом аммония, например глобулином сыворотки и овоглобулином.

(c) Глютелины:

Нерастворимы в воде и нейтральных растворителях. Растворим в разбавленных кислотах и ​​щелочах. Они коагулируют под действием тепла, например глютелин пшеницы.

(d) Проламины:

Нерастворим в воде, но растворим в 70% спирте, например, в глиадине пшеницы, белках кукурузы, ячменя и т. Д.

(e) Истории:

Водорастворимый, основной по своей природе из-за присутствия аргинина и лизина, обнаруженных в ядре. Они помогают в упаковке ДНК в клетке. Они образуют белковый фрагмент нуклеопротеина.

(f) Протамины:

Водорастворимый, основной по своей природе, не подвергается тепловой коагуляции. Находится в сперматозоидах, следовательно, является компонентом нуклеопротеина сперматозоидов.

(г) Глобина:

Они растворимы в воде, не подвергаются тепловой коагуляции.например, глобин гемоглобина.

(h) Альбуминоиды или склеропротеины:

Нерастворимо во всех нейтральных растворителях, разбавленных кислотах или щелочах, например, в кератине волос и протеинах костей и хрящей.

2. Конъюгированные белки:

Белки, состоящие из аминокислот и не аминокислотного / белкового вещества, называемого простетической группой, известны как конъюгированные белки.

Различные типы конъюгированных белков:

(а) Хромобелки:

Здесь небелковая часть представляет собой окрашенное соединение в дополнение к белковой части.Бывший. Гемоглобин имеет гем в качестве простетической группы, а цитохромы также содержат гем.

(б) Нуклеопротеины:

Эти белки связаны с нуклеиновыми кислотами, например с хроматином (гистоны + нуклеиновые кислоты).

(c) Гликопротеины:

Когда небольшое количество углеводов присоединяется к белку, он известен как гликопротеины, например муцин слюны. (Примечание: гликопротеины содержат большое количество белка и некоторое количество углеводов, а протеогликаны содержат большое количество углеводов и небольшое количество белков).

(г) Pbosphoprotein:

Фосфорная кислота присутствует в белке. Бывший. Молочный казеин и яичный желток (желтеллин).

(e) Липопротеины:

Белки в сочетании с липидами, например, ЛПНП, ЛПВП.

(е) Металлопротеины:

Помимо аминокислот, они содержат ионы металлов, например, гемоглобин (железо), церулоплазмин (медь).

3. Производные белки:

Это белки с низким молекулярным весом, полученные из белков с большим молекулярным весом под действием тепла, ферментов или химических агентов.

Белки → Белки → Протеозы → Пептоны → Пептиды → Аминокислоты

Свойство протеина — обзор

Для этого исследования последовательности протеина были получены из UniProt, который является хранилищем свойств протеина. BEST1 записан с самой длинной последовательностью длиной 585 аминокислот, тогда как PRPh3 с самой короткой последовательностью длиной 346 аминокислот.Мы рассчитали состав каждой аминокислоты в BEST1 и PRPh3 с помощью статистического анализа белковых последовательностей (SAPS) (Brendel, Bucher, Nourbakhsh, Blaisdell, & Karlin, 1992). Наблюдался больший состав лейцина, за которым следуют пролин, серин и глутамин в BEST1 (рис. 6.7A). Точно так же в последовательности PRPh3 мы распознали лагерный состав лейцина, за которым следовали серин, лизин и глицин (фиг. 6.7A). Кроме того, мы также рассчитали склонность каждой аминокислоты в нативном и мутантном состоянии BEST1 и PRPh3 (рис.6.7Б). В BEST1 наиболее распространенной аминокислотой в нативном состоянии был лейцин, в то время как валин был наиболее распространенной заменой в PRPh3 (таблица 6.1). Leu → Val, Val → Met, Asp → Asn, Glu → Lys и Leu → Pro были наиболее частыми заменами из-за SAP. Было предсказано, что восемь замен от Leu → Val и семь замен от Val → Met являются патогенными с помощью PolyPhen-2, SNP и GO, а также SIFT, PolyPhen-2 и PANTHER. Шесть замен из Asp → Arg, Glu → Lys и Leu → Pro были предсказаны как патогенные с помощью PolyPhen-2 и I-MUTANT Suite, PhD-SNP и I-MUTANT Suite, а также PolyPhen-2, PhD-SNP, SNAP, SNPs & GO и I-MUTANT Suite соответственно.Для PRPh3 наиболее распространенной аминокислотой дикого типа был Pro, в то время как Arg был наиболее распространенной аминокислотой замещения. R → W, G → D, P → L, R → W, C → Y, G → S и P → R были наиболее частыми заменами из-за SAP. Из таблицы 6.1 мы можем сделать вывод, что появление пяти замен из Arg → Trp и Gly → Asp было предсказано как патогенное с помощью PhD-SNP, PANTHER, SNAP, I-MUTANT Suite и Align-GVGD и PANTHER, SNAP, I- MUTANT Suite и Align-GVGD соответственно. Четыре замены Pro → Leu были предсказаны PANTHER, I-MUTANT Suite и Align-GVGD как патогенные, а три замены из Cys → Tyr, Gly → Ser и Pro → Arg были предсказаны SIFT, PolyPhen- 2, PhD-SNP, SNAP, I-MUTANT Suite и Align-GVGD; PolyPhen-2, PANTHER, I-MUTANT Suite и Align-GVGD; и PolyPhen-2, PANTHER, SNAP, I-MUTANT Suite и Align-GVGD соответственно.

Рисунок 6.7. (А) Состав аминокислот в BEST1 и PRPh3 путем статистического анализа белковых последовательностей. (B) Состав аминокислот в варианте и положении замещения BEST1 и PRPh3.

Функциональные свойства белков — обзор

Разрушение клеток и выделение белка

Было разработано множество процессов, разрушающих клетки. Распространенным является автолиз, при котором биомасса подвергается тепловому шоку или воздействию химических соединений, таких как низкомолекулярные тиолы.Автолиз дрожжей обычно происходит при нагревании клеток до 45–55 ° C и усиливается за счет NaCl. Дальнейшая инкубация в течение примерно 24 часов индуцирует клеточные ферменты, что приводит к полному лизису клеток. Этот процесс также активирует эндогенные рибонуклеазы, восстанавливающие нуклеиновые кислоты. Лизу может способствовать добавление экзогенных ферментов, таких как протеазы, β-глюканазы или лизоцим. Недостатками этих методов являются высокая стоимость и обширный протеолиз, который снижает выход и функциональные свойства белков.Также используются химические обработки щелочами, органическими растворителями или солями, которые ослабляют стенки клеток. Щелочная обработка может привести к нежелательным побочным реакциям с образованием таких соединений, как лизиноаланин, и неприятных запахов.

Гидролиз требует использования соляной кислоты при температуре до 100 ° C для обработки суспензии с содержанием твердых веществ 65–85% с последующей нейтрализацией NaOH. Этот процесс имеет много недостатков, таких как риск несчастных случаев с концентрированной кислотой, использование дорогостоящего антикоррозионного оборудования и разрушение некоторых аминокислот и витаминов, снижающих питательную ценность продукта.

Наиболее широко используются физические методы разрушения клеточных стенок. Высокие скорости сдвига достигаются с помощью гомогенизаторов или коллоидных мельниц и широко используются для процессов SCP.

После того, как клетки разрушены, белок экстрагируется водой или щелочью; остатки клеточной стенки удаляются центрифугированием, и белок дополнительно осаждается с помощью кислоты, соли или тепловой обработки, в то время как нуклеиновые кислоты остаются в надосадочной жидкости. Обычно микробные белки имеют максимальную растворимость при pH 12, а осаждение происходит при pH 4.5. Затем получают белковый изолят. Некоторые химические модификации во время экстракции белка включают фосфорилирование или сукцинилирование, которые облегчают отделение белка от нуклеиновых кислот и улучшают его функциональные свойства.

Идентификация функций белков с использованием подхода машинного обучения на основе свойств, полученных из последовательностей | Proteome Science

  • 1.

    Альтшул С.Ф., Гиш В., Миллер В., Майерс Э. У., Липман Д. Д.: Базовый инструмент поиска локального совмещения. J Mol Biol 1990, 215: 403–410.

    CAS PubMed Статья Google ученый

  • 2.

    Альтшул С.Ф., Мэдден Т.Л., Шаффер А.А., Чжан Дж., Чжан З., Миллер В., Липман Д.Д.: Gapped BLAST и PSI-BLAST: новое поколение программ поиска в базе данных белков. Nucleic Acids Res 1997, 35: 3389–3402.

    Артикул Google ученый

  • 3.

    Pearson WR, Lipman DJ: Улучшенные инструменты для сравнения биологических последовательностей. Proc Natl Acad Sci USA 1988, 85: 2444–2448.

    CAS PubMed Central PubMed Статья Google ученый

  • 4.

    Беннер С.А., Чемберлин С.Г., Либерлес Д.А., Говиндараджан С., Кнехт L: Функциональные выводы реконструированной эволюционной биологии с использованием исправленных баз данных — эволюционно обоснованный подход к функциональной геномике. Res Microbiol 2000, 151: 97–106.

    CAS PubMed Статья Google ученый

  • 5.

    Cai CZ, Han LY, Ji ZL, Chen X, Chen YZ: Классификация семейств ферментов с помощью опорных векторных машин. Белки 2004, 55: 66–76.

    CAS PubMed Статья Google ученый

  • 6.

    Dobson PD, Doig AJ: Прогнозирование класса ферментов по структуре белка без выравнивания. J Mol Biol 2005, 345: 187–199.

    CAS PubMed Статья Google ученый

  • 7.

    Хан LY, Cai CZ, Ji ZL, Cao ZW, Cui J, Chen YZ: Прогнозирование функционального семейства новых ферментов независимо от сходства последовательностей: подход статистического обучения. Nucleic Acids Res 2004, 32: 6437–6444.

    CAS PubMed Central PubMed Статья Google ученый

  • 8.

    Wang X, Schroeder D, Dobbs D, Honavar V: Автоматизированное обнаружение на основе данных классификаторов функций белков на основе мотивов. Inf Sci 2003, 155: 1–18.

    Артикул Google ученый

  • 9.

    Lapinsh M, Gutcaits A, Prusis P, Post C, Lundstedt T, Wikberg JES: Классификация рецепторов, связанных с G-белком, путем выделения независимых от выравнивания основных химических свойств первичных аминокислотных последовательностей. Protein Sci 2002, 11: 795–805.

    CAS PubMed Central PubMed Статья Google ученый

  • 10.

    Rost B: Сумеречная зона выравнивания последовательностей белков. Protein Eng 1999, 12: 85–94.

    CAS PubMed Статья Google ученый

  • 11.

    Хобом У., Сандер С: Подход на основе свойств последовательности к поиску в базах данных белков. J Mol Biol 1995, 251: 390–399.

    CAS PubMed Статья Google ученый

  • 12.

    Claeyssens M, Henrissat B: Картирование специфичности целлюлолитических ферментов: классификация по семействам структурно родственных белков, подтвержденная биохимическим анализом. Protein Sci 1992, 1: 1293–1297.

    CAS PubMed Central PubMed Статья Google ученый

  • 13.

    Karp PD: Что мы не знаем об анализе последовательностей и базе данных последовательностей. Биоинформатика 1998, 14: 753–754.

    CAS PubMed Статья Google ученый

  • 14.

    Хокинс Т., Кихара Д: Функциональное предсказание неохарактеризованных белков. Дж. Bioinform Comput Biol 2007, 5: 1–30.

    CAS PubMed Статья Google ученый

  • 15.

    Holm L, Sander C: Dali: сетевой инструмент для сравнения структуры белков. Trends Biochem Sci 1995, 20: 478–480.

    CAS PubMed Статья Google ученый

  • 16.

    Kawabata T: MATRAS: программа для сравнения трехмерной структуры белков. Nucleic Acids Res 2003, 31: 3367–3369.

    CAS PubMed Central PubMed Статья Google ученый

  • 17.

    Eidhammer I, Jonassen I, Taylor WR: Сравнение структуры белков и структурные модели. Дж. Comput Biol 2000, 7: 685–716.

    CAS PubMed Статья Google ученый

  • 18.

    Friedberg I: Автоматизированное предсказание функции белков — геномная проблема. Краткая биоинформатика 2006, 7: 225–242.

    CAS PubMed Статья Google ученый

  • 19.

    Russell RB, Saqi MA, Bates PA, Sayle RA, Sternberg MJ: Распознавание аналогичных и гомологичных белковых складок — оценка успеха прогнозирования и соответствующей точности выравнивания с использованием эмпирических матриц замещения. Protein Eng 1998, 11: 1–9.

    CAS PubMed Статья Google ученый

  • 20.

    Syed U, Yona G: Прогнозирование ферментной функции с помощью интерпретируемых моделей. В Вычислительная системная биология .Под редакцией: Самудрала Р., Макдермотт Дж., Бамгарнер Р. Нью-Йорк: Humana Press; 2007: 1–33.

    Google ученый

  • 21.

    Borro LC, Oliveira SRM, Yamagishi MEB, Mancini AL, Jardine JG, Mazoni I, Santos EHD, Higa RH, Kuser PR, Neshich G: Прогнозирование класса ферментов по структуре белка с использованием байесовской классификации. Genet Mol Res 2006, 5: 193–202.

    CAS PubMed Google ученый

  • 22.

    Cai CZ, Han LY, Ji ZL, Chen X, Chen YZ: SVM-Prot: компьютерное программное обеспечение вспомогательных векторов на базе Интернета для функциональной классификации белка по его первичной последовательности. Nucleic Acids Res 2003, 31: 3692–3697.

    CAS PubMed Central PubMed Статья Google ученый

  • 23.

    Дженсен Л.Дж., Гупта Р., Блом Н., Девос Д., Тамамес Дж., Кесмир К., Нильсен Х., Стерфельдт Х.Х., Рапаки К., Уоркман С., Андерсен CAF, Кнудсен С., Крог А., Валенсия А, Брунак С. : Прогнозирование функции белков человека на основе посттрансляционных модификаций и особенностей локализации. J Mol Biol 2002, 319: 1257–1265.

    CAS PubMed Статья Google ученый

  • 24.

    Дженсен Л.Дж., Сковгаард М., Брунак S: Прогнозирование новых архейных ферментов на основе характеристик, полученных из последовательности. Protein Sci 2002, 3: 2894–2898.

    Google ученый

  • 25.

    Паскье С., Промпонас В.Дж., Хамодракас SJ: PRED-CLASS: каскадные нейронные сети для обобщенной классификации белков и приложений для всего генома. Белки 2001, 44: 361–369.

    CAS PubMed Статья Google ученый

  • 26.

    Chen YC, Lin YS, Lin CJ, Hwang JK: Прогнозирование состояний связывания цистеинов с использованием машин опорных векторов на основе множественных векторов признаков и последовательностей состояний цистеина. Белки 2004, 55: 1036–1042.

    CAS PubMed Статья Google ученый

  • 27.

    Yuan Z, Burrage K, Mattick JS: Прогнозирование доступности белковых растворителей с использованием машин опорных векторов. Белки 2002, 48: 566–570.

    CAS PubMed Статья Google ученый

  • 28.

    Noble WS, Ben-Hur A: Объединение информации для прогнозирования функции белков. В Биоинформатика — От геномов к терапии . Под редакцией: Ленгауэр Т. Вайнхайм: Wiley-VCH Verlag GmbH & Co KGaA; 2007: 1297–1314.

    Глава Google ученый

  • 29.

    Cai CZ, Wang WL, Sun LZ, Chen YZ: Классификация функций белков с помощью метода опорных векторов. Math Biosci 2003, 185: 111–122.

    CAS PubMed Статья Google ученый

  • 30.

    Bendtsen JD, Jensen LJ, Blom N, Heijne GV, Brunak S: Предсказание на основе характеристик неклассической секреции белка и секреции белка без лидера. Protein Eng Des Sel 2004, 17: 349–356.

    CAS PubMed Статья Google ученый

  • 31.

    Dobson PD, Doig AJ: Отличие ферментных структур от неферментных без выравнивания. J Mol Biol 2003, 330: 771–783.

    CAS PubMed Статья Google ученый

  • 32.

    Al-Shahib A, Breitling R, Gilbert D: FRANKSUM: новый метод выбора характеристик для предсказания функции белков. Int J Neural Syst 2005, 15: 250–275.

    Артикул Google ученый

  • 33.

    Аль-Шахиб А., Брейтлинг Р., Гилберт Д.: Выбор характеристик и проблема дисбаланса классов при прогнозировании функции белка по последовательности. Appl Bioinformatics 2005, 4: 195–203.

    CAS PubMed Статья Google ученый

  • 34.

    Ван И, Тетко И.В., Холл М.А., Фрэнк Э., Фасиус А., Майер KFX, Mewes HW: Выбор гена из данных микрочипа для классификации рака — подход машинного обучения. Comput Biol Chem 2005, 29: 37–46.

    PubMed Статья Google ученый

  • 35.

    Zhao XM, Li X, Chen L, Aihara K: Классификация белков с несбалансированными данными. Белки 2008, 70: 1125–1132.

    CAS PubMed Статья Google ученый

  • 36.

    Ding CH, Dubchak I: Распознавание мультиклассовых белковых складок с использованием опорных векторных машин и нейронных сетей. Биоинформатика 2001, 17: 349–358.

    CAS PubMed Статья Google ученый

  • 37.

    Fujishima K, Komasa M, Kitamura S, Suzuki H, Tomita M, Kanai A: Протеомное предсказание новых ДНК / РНК-связывающих белков с использованием аминокислотного состава и периодичности в гипертермофильном архее Pyrococcus furiosus . DNA Res 2007, 14: 91–102.

    CAS PubMed Central PubMed Статья Google ученый

  • 38.

    Borgwardt KM, Ong CS, Schonauer S, Vishwanathan SVN, Smola AJ, Kriegel HP: Предсказание функции белка с помощью ядер графов. Биоинформатика 2005, 21: i1-i10.

    Артикул Google ученый

  • 39.

    Zheng G, Qian Z, Yang Q, Wei C, Xie L, Zhu Y, Li Y: Комбинированный подход SVM и ECOC для мощной идентификации и классификации факторов транскрипции. BMC Bioinformatics 2008, 9: 282.

    PubMed Central PubMed Статья Google ученый

  • 40.

    Tung CW, Ho SY: Вычислительная идентификация сайтов убиквитилирования из белковых последовательностей. BMC Bioinformatics 2008, 9: 310.

    PubMed Central PubMed Статья Google ученый

  • 41.

    Judson R, Elloumi F, Setzer RW, Li Z, Shah I: Сравнение алгоритмов машинного обучения для классификации химической токсичности с использованием смоделированной многомасштабной модели данных. BMC Bioinformatics 2008, 9: 241.

    PubMed Central PubMed Статья Google ученый

  • 42.

    Гарг А., Гупта D: VirulentPred: метод прогнозирования вирулентных белков в бактериальных патогенах на основе SVM. BMC Bioinformatics 2008, 9: 62.

    PubMed Central PubMed Статья Google ученый

  • 43.

    Кумар М., Громиха М.М., Рагхава GPS: Идентификация ДНК-связывающих белков с использованием опорных векторных машин и эволюционных профилей. BMC Bioinformatics 2007, 8: 463.

    CAS PubMed Central PubMed Статья Google ученый

  • 44.

    Pugalenthi G, Tang K, Suganthan PN, Archunan G, Sowdhamini R: Подход с машинным обучением для идентификации белков, связывающих одорант, на основе свойств, полученных из последовательности. BMC Bioinformatics 2007, 8: 351.

    PubMed Central PubMed Статья Google ученый

  • 45.

    Li Q, Lai L: Прогнозирование потенциальных мишеней лекарств на основе простых свойств последовательности. BMC Bioinformatics 2007, 8: 353.

    PubMed Central PubMed Статья Google ученый

  • 46.

    Chen XW, Liu M: Прогнозирование белок-белковых взаимодействий с использованием структуры леса случайных решений. Биоинформатика 2005, 21: 4394–4400.

    CAS PubMed Статья Google ученый

  • 47.

    Amaratunga D, Cabrera J, Lee YS: Обогащенные случайные леса. Биоинформатика 2008, 24: 2010–2014.

    CAS PubMed Статья Google ученый

  • 48.

    Дэвис М.Н., Секер А., Фрейтас А.А., Мендао М., Тиммис Дж., Флауэр DR: Об иерархической классификации рецепторов, связанных с G-белком. Биоинформатика 2007, 23: 3113–3118.

    CAS PubMed Статья Google ученый

  • 49.

    Гальперин I, Глейзер Д.С., Ву С., Альтман РБ: Фреймворк FEATURE для аннотации функций белков: моделирование новых функций, повышение производительности и распространение на новые приложения. BMC Genomics 2008, 16: 9.

    Google ученый

  • 50.

    Густафсон AM, Сниткин ES, Parker SCJ, DeLisi C, Kasif S: На пути к идентификации основных генов с использованием целевого секвенирования генома и сравнительного анализа. BMC Genomics 2006, 7: 265.

    PubMed Central PubMed Статья Google ученый

  • 51.

    Гуан Ю., Майерс К.Л., Хесс Д.К., Баруткуоглу З., Кауди А.А., Троянская О.Г.: Прогнозирование функции генов в иерархическом контексте с помощью ансамбля классификаторов. Genome Biol 2008, 9: S3.

    PubMed Central PubMed Статья Google ученый

  • 52.

    Caragea C, Sinapov J, Silvescu A, Bobbs D, Honavar V: Предсказание сайта гликозилирования с использованием ансамблей машинных классификаторов опорных векторов. BMC Bioinformatics 2007, 8: 438.

    PubMed Central PubMed Статья Google ученый

  • 53.

    Ge G, Wong GW: Классификация данных масс-спектрометрии предракового рака поджелудочной железы с использованием ансамблей дерева решений. BMC Bioinformatics 2008, 9: 275.

    PubMed Central PubMed Статья Google ученый

  • 54.

    Strobl C, Boulesteix AL, Kneib T, Augustin T, Zeileis A: Важность условных переменных для случайных лесов. BMC Bioinformatics 2008, 9: 307.

    PubMed Central PubMed Статья Google ученый

  • 55.

    Статников А., Ван Л., Алиферис CF: Комплексное сравнение случайных лесов и вспомогательных векторных машин для классификации рака на основе микрочипов. BMC Bioinformatics 2008, 9: 319

    PubMed Central PubMed Статья Google ученый

  • 56.

    Todd AE, Orengo CA, Thornton JM: Эволюция функции в суперсемействах белков со структурной точки зрения. J Mol Biol 2001, 307: 1113–1143.

    CAS PubMed Статья Google ученый

  • 57.

    Bairoch A, Apweiler R: Банк данных последовательности белков SWISS-PROT и дополнение к нему TrEMBL в 1999 году. Nucleic Acids Res 1999, 27: 49–54.

    CAS PubMed Central PubMed Статья Google ученый

  • 58.

    Здобавов Е.М., Лопес Р., Апвейлер Р: Сервер EBI SRS — новые возможности. Биоинформатика 2002, 18: 1149–1150.

    CAS PubMed Статья Google ученый

  • 59.

    Gasteiger E, Hoogland C, Gattiker A, Duvaud S, Wilkins MR, Appel RD, Bairoch A: Инструменты для идентификации и анализа белков на сервере ExPASy. В Справочник по протоколам протеомики . Отредактировал: Джон М.В. Нью-Йорк: Humana Press; 2005: 571–607.

    Глава Google ученый

  • 60.

    Truniger V, Lazaro JM, Esteban FJ, Blanco L, Salas M: Положительно заряженный остаток ДНК-полимеразы φ29, высококонсервативный в ДНК-полимеразах семейств A и B, участвует в связывании поступающего нуклеотида. Nucleic Acids Res 2002, 30: 1483–1492.

    CAS PubMed Central PubMed Статья Google ученый

  • 61.

    Cappello V, Tramontano A, Koch U: Классификация белков на основе свойств лиганд-связывающего сайта: случай аденин-связывающих белков. Белки 2002, 47: 106–115.

    CAS PubMed Статья Google ученый

  • 62.

    Каруана Р., де Са VR: Использование переменных, которые отбрасываются при выборе переменных. J Mach Learn Res 2003, 3: 1245–1264.

    Google ученый

  • 63.

    Saeys Y, Inza I., Larranaga P: Обзор методов выбора признаков в биоинформатике. Биоинформатика 2007, 23: 2507–2517.

    CAS PubMed Статья Google ученый

  • 64.

    Guyon I, Elisseeff A: Введение в выбор переменных и функций. J Mach Learn Res 2003, 3: 1157–1182.

    Google ученый

  • 65.

    Hall MA, Holmes B: Методы выбора атрибутов сравнительного анализа для интеллектуального анализа данных дискретных классов. IEEE Trans Knowl Data Eng 2003, 15: 1–16.

    Артикул Google ученый

  • 66.

    Файяд У, Ирани K: Многоинтервальная дискретизация непрерывнозначных атрибутов для обучения классификации. В материалах 13-й Международной совместной конференции по ИИ: 28 августа — 3 сентября 1993 г ​​.; Шамбери . Сан-Франциско: Морган Кауфманн; 1993: 1022–1027.

    Google ученый

  • 67.

    Ян Х: Интеллектуальный анализ данных: практические инструменты и методы машинного обучения . Сан-Франциско: Морган Кауфманн; 2005 г.[http://www.cs.waikato.ac.nz/ml/weka/]

    Google ученый

  • 68.

    Брейман L: Случайные леса. В Машинное обучение . Отредактировал: Schapire RE. Нидерланды: Спрингер; 2001: 5–32.

    Google ученый

  • 69.

    Chang CC, Lin CJ: LIBSVM: библиотека для поддержки векторных машин. 2001. [http://www.csie.ntu.edu.tw/~cjlin/libsvm]

    Google ученый

  • 70.

    Эль-Манзалави Y: WLSVM. 2005. [http://www.cs.iastate.edu/~yasser/wlsvm/]

    Google ученый

  • 71.

    Baldi P, Brunak S, Chauvin Y, Andersen CAF, Nielsen H: Оценка точности алгоритмов прогнозирования для классификации: обзор. Биоинформатика 2000, 16: 412–424.

    CAS PubMed Статья Google ученый

  • 72.

    Matthews BW: Сравнение предсказанной и наблюдаемой вторичной структуры лизоцима фага Т4. Biochim Biophys Acta 1975, 405: 442–451.

    CAS PubMed Статья Google ученый

  • 73.

    Tan PN, Steinbach M, Kumar V: Введение в интеллектуальный анализ данных . Бостон: Эддисон Уэсли; 2006.

    Google ученый

  • 74.

    Хуанг Дж., Линг CX: Использование AUC и точности при оценке алгоритмов обучения. IEEE Trans Knowl Data Eng 2005, 17: 299–310.

    CAS Статья Google ученый

  • 75.

    Hand DJ, Till RJ: Простое обобщение площади под кривой roc для задач классификации нескольких классов. В Машинное обучение . Отредактировал: Aha DW. Нидерланды: Kluwer Academic Publishers; 2001: 171–186.

    Google ученый

  • 76.

    Ofran Y, Margalit H: Белки с одинаковой укладкой и неродственные последовательности имеют сходный аминокислотный состав. Белки 2006, 64: 275–279.

    CAS PubMed Статья Google ученый

  • 77.

    Xie D, Li A, Wang M, Fan Z, Feng H: LOCSVMPSI: веб-сервер для субклеточной локализации эукариотических белков с использованием SVM и профиля PSI-BLAST. Nucleic Acids Res 2005, 33: W105–110.

    CAS PubMed Central PubMed Статья Google ученый

  • 78.

    Дэвис М.Н., Секер А., Фрейтас А.А., Кларк Э., Тиммис Дж., Флауэр DR: Оптимизация группировок аминокислот для классификации GPCR. Биоинформатика 2008, 24: 1980–1986.

    CAS PubMed Статья Google ученый

  • 79.

    Verma S, Bednar V, Blount A, Hogue BG: Идентификация функционально важных отрицательно заряженных остатков в карбокси-конце нуклеокапсидного белка вируса гепатита A59 мыши. J Virol 2006, 80: 4344–4355.

    CAS PubMed Central PubMed Статья Google ученый

  • 80.

    Andersson H, Bakker E, Heijne G: Различные положительно заряженные аминокислоты имеют сходные эффекты на топологию политопного трансмембранного белка в Escherichia coli . J Biol Chem 1992, 267: 1491–1495.

    CAS PubMed Google ученый

  • 81.

    Rutz C, Rosenthal W, Schulein R: Один отрицательно заряженный остаток влияет на ориентацию мембранного белка во внутренней мембране Escherichia coli только тогда, когда он расположен рядом с трансмембраной домен. J Biol Chem 1999, 274: 33757–33763.

    CAS PubMed Статья Google ученый

  • 82.

    Boyd D, Manoil C, Beckwith J: Детерминанты топологии мембранных белков. Proc Natl Acad Sci USA 1987, 84: 8525–8529.

    CAS PubMed Central PubMed Статья Google ученый

  • Прогнозирование функций белков у мышей на основе взвешенной сети взаимодействия белок-белок и свойств гибридных белков

    Во-первых, каждый белок кодируется в вектор признаков с использованием свойств гибрида.Во-вторых, функции отсортированы по убыванию методом mRMR. В-третьих, для выбора наиболее эффективного предиктора, построенного с помощью алгоритма ближайшего соседа, был применен метод инкрементного выбора признаков.

    Биохимическое и физико-химическое описание белков.

    Многие исследования показали, что показатели успеха для прогнозирования свойств белка можно значительно улучшить, включив различные биохимические или физико-химические свойства в дескрипторы образцов белка [39], [40] и длинный список соответствующих ссылок, цитируемых в недавнем обзоре [41]).Следовательно, биохимические и физико-химические свойства (гибридные свойства) белков используются для кодирования белков. Как следует из названия, он состоит из двух видов свойств: (1) биохимических свойств, включая две особенности: аминокислотный состав и вторичную структурную предрасположенность; (2) Физико-химические свойства, включая пять характеристик: поляризуемость, доступность растворителя, нормированный ван-дер-ваальсовый объем и полярность [40].

    Из перечисленных выше семи характеристик, за исключением аминокислотного состава, который представляет собой расширенное количество, отражающее весь белок, остальные являются локальными количествами, отражающими каждую из составляющих аминокислот.Каждую из таких локальных количественных характеристик можно разделить на две или три группы. Например, для каждой аминокислоты склонность к вторичной структуре характеризуется как три группы: спираль, лист и клубок, как предсказал Predator [42]; гидрофобность подразделяется на полярную, нейтральную или гидрофобную [43]; доступность растворителя помечена PredAcc как «скрытая или подверженная действию растворителя» [44].

    Биохимический или физико-химический характер белковой последовательности может отражаться через каждое из этих локальных свойств.Например, с использованием P, N и H для представления трех групп гидрофобности: полярной, нейтральной и гидрофобной, данная последовательность белка «MSDKPDMAEIEKFSKETIEQEKQAGESTQEKNPLPMLLPATDKSKLKKTE» может быть преобразована в «HNPPNPHNPHPNPNPNPNPNPNPNPNPNPNPNPNPNPNPNPNP».

    Для каждой такой последовательности букв можно получить три свойства: состав (C), переход (T) и распределение (D). C описывает общий процентный состав каждой из групп в буквенной последовательности; T — процентная частота смены одной буквы на другую по всей длине последовательности букв; и D — образец распределения букв по последовательности, измеряющий процент длины последовательности, в пределах которой расположены первая, 25%, 50%, 75% и 100% аминокислот каждой буквы.

    В качестве примера возьмем последовательность из 50 букв, описанную выше. Он состоит из 10 Hs, 16Ns, 24Ps. Первая функция C — это, и для H, N и P соответственно. Для признака T в последовательности всего 31 переход, из которых 8 между H и N, 16 между N и P и 7 между H и P, поэтому признак T может быть вычислен как, и, соответственно. Первые 25%, 50%, 75% и 100% буквы H расположены на позициях 1, 10, 18, 37 и 46 в буквенной последовательности.Таким образом, признак D для H — это,,,, и. Характеристика D для N и P может быть рассчитана аналогичным методом, и результаты следующие: характеристика D для N составляет 4%, 28%, 54%, 78% и 98%; а для P — 6%, 24%, 44%, 64% и 100% соответственно. При всем этом три свойства буквенной последовательности — это, и, всего 21 функция.

    Для доступности растворителя существует только две локальные группы функций, и, следовательно, получается семь функций, а не 21, как показано выше.Аминокислотные композиции имеют 20 характеристик, каждая из которых представляет процент или частоту встречаемости составляющих аминокислот в образце белка [45]. Для каждого из пяти других свойств локальных свойств можно получить 21 глобальный признак, как в случае гидрофобности, описанной выше. Используя все эти результаты, можно получить в общей сложности 132 () признака, представляющих последовательность белка. В таблице перечислены 132 функции, использованные в нашем исследовании.

    После того, как каждый белок был закодирован, к набору векторов применялись два критерия.(1) Исключены белки с одинаковыми кодирующими векторами, но разными функциональными категориями. (2) Сохраните один из белков, которые имеют общие кодирующие векторы и функциональные категории.

    Сортировка признаков.

    Метод максимальной релевантности, минимальной избыточности (mRMR) был первоначально разработан Peng и др. . для обработки данных микрочипов [46]. Идея состоит в том, чтобы ранжировать каждую функцию на основе ее соответствия цели и дублирования с другими функциями. «Хорошая» функция определяется как такая, которая имеет наилучший компромисс между максимальной релевантностью для цели и минимальной избыточностью в рамках функций.Для количественной оценки релевантности и избыточности взаимная информация (MI), которая оценивает, насколько один вектор связан с другим, определяется следующим образом. (7)

    где, — два вектора, — совместная вероятностная плотность, — предельные вероятностные плотности.

    Let обозначает весь набор функций, а обозначает уже выбранный набор функций, который содержит векторы. Выбранный набор функций с функциями обозначается значком. Соответствие функции цели можно рассчитать по: (8)

    И избыточность элемента f in со всеми функциями может быть рассчитана по: (9)

    Чтобы получить функцию с максимальной актуальностью и минимальной избыточностью, уравнение.(8) и уравнение. (9) объединяются для получения функции mRMR: (10)

    Для набора функций с, оценка функции будет выполняться циклически. В первом раунде избыточность равна 0 для нулевого значения, поэтому выбирается функция с максимальной релевантностью для цели. После оценок следующий набор функций в порядке выбора может быть получен методом mRMR: (11) где индекс нижнего индекса указывает, в каком раунде выбран объект. Чем лучше функция, тем раньше она будет удовлетворять уравнению.(10), чем раньше он будет выбран, тем меньше будет его индекс.

    Структура и свойства белка | SpringerLink

  • 1.

    Вебер, Г., и У. Дж. Тил, в «Белках», том. 3, под редакцией Х. Нейрата, Academic Press, Нью-Йорк, 1965, стр. 445.

    Google ученый

  • 2.

    Smith, J.M., Nature 225: 563 (1970).

    Артикул CAS Google ученый

  • 3.

    Schellman, J.A., and C. Schellman, in «The Proteins», Vol. 2, под редакцией Х. Нейрата, Academic Press, Нью-Йорк, 1964, стр. 1.

    Google ученый

  • 4.

    Schechter, I., and A. Burger, Biochemistry 5: 3362 (1966).

    Артикул CAS Google ученый

  • 5.

    Шредер, Э., и В. Любке, в «Пептиды», Academic Press, New York, 1965.

    Google ученый

  • 6.

    Венкатачалам, C.M., and G.N. Рамачандран, Энн. Rev. Biochem. 38:45 (1969).

    Артикул CAS Google ученый

  • 7.

    Eck, R.V., and M.O. Dayoff, «Атлас последовательности и структуры белков», Национальный фонд биомедицинских исследований, Silver Springs, 1969.

  • 8.

    Pauling, L., R.B. Corey и H.R. Branson, Proc. Nat. Акад. Sci. США 37: 205 (1951).

    Артикул CAS Google ученый

  • 9.

    Блейк, C.C.F., D.F. Кениг, Г.А. Mair, A.C.T. Норт, Д.К. Филлипс и В. Сарма, Nature, 206: 757 (1965).

    Артикул CAS Google ученый

  • 10.

    Phillips, D.C., Sci. Амер. 291 (11): 78 (1966).

    Артикул Google ученый

  • 11.

    Perutz, M.F., Europ. J. Biochem. 8: 455 (1969).

    Артикул CAS Google ученый

  • 12.

    Брэдшоу, Р.А., Х. Нейрат, К.А. Walsh, Proc. Nat. Акад. Sci. США 63: 406 (1969).

    Артикул CAS Google ученый

  • 13.

    Рупли, Дж. А., в «Биологические макромолекулы», Vol. 2 Часть 1, Отредактировал С. Тимашев и Г.Д. Фасман, Marcel Dekker, Inc., Нью-Йорк, 1970.

    Google ученый

  • 14.

    Батлер, Л.Г., и Дж. А. Rupley, J. Biol. Chem. 242: 1077 (1967).

    CAS Google ученый

  • 15.

    Ларри Г. Батлер, «Очистка и идентификация фосфопротеина из митохондрий бычьей печени», доктор философии. Диссертация, Калифорнийский университет, Лос-Анджелес, 1964.

  • 16.

    Pusztai, A., Biochem. J. 101: 256 (1966).

    Google ученый

  • 17.

    Gordon, J., and W.P. Дженкс, Биохимия 2:47 (1963).

    Артикул CAS Google ученый

  • 18.

    Gordon, J.A., and J.R. Warren, J. Biol. Chem. 243: 5663 (1968).

    CAS Google ученый

  • 19.

    Boyer, P.D., в «The Enzymes», Vol. 1, под редакцией П.Д. Бойер, Х. Ларди и К. Мирбэк, Academic Press, Нью-Йорк, 1959, с. 511.

    Google ученый

    ,
  • ,
  • , 20.

    , Perrin, D., and J. Monod, Biochem. Биофиз. Res. Commun. 12: 425 (1963).

    Артикул CAS Google ученый

  • 21.

    Gutte, B., and R.B. Merrifield, J. Amer. Chem. Soc. 91: 501 (1969).

    Артикул CAS Google ученый

  • 22.

    Denkewalter, R.G., D.F. Вебер, Ф.В. Холли, Р. Хиршманн, Р. Страчан, У.Дж. Палеведа-младший, Р.Ф. Натт, Р.А. Виталий, М.Дж. Дикенсон, В. Гарский, Дж. Э. Дик, Э. Уолтон, С. Дженкинс, Р. Дьюи, Т. Ланца, Э.Ф. Шеневальдт, Х. Баркемейер, Дж. Сонди, С.Л. Варга, Дж.Д. Милковски, Х. Джошуа, Дж. Б. Конн и Т.А. Иаков, Там же.91: 502–508 (1969).

    Артикул CAS Google ученый

  • 23.

    Scott, R.A., G. Vanderkooi, R.W. Tuttle, P.M. Шеймс и Х. Scheraga, Proc. Natl. Акад. Sci. США 58: 2204 (1967).

    Артикул CAS Google ученый

  • 24.

    Edman, P., and G. Begg, Europ. J. Biochem. 1:80 (1967).

    Артикул CAS Google ученый

  • 25.

    Сторм, Д. Р. и Д. Э. Koshland, Jr., Proc. Nat. Акад. Sci. США 66: 445 (1970).

    Артикул CAS Google ученый

  • 26.

    Low, B.W., and J.T. Эдсалл, «Течения в биохимических исследованиях», под редакцией Д.Е. Грин, Interscience Publishers, Нью-Йорк, 1956.

    Google ученый

  • 27.

    Fox, S., and J.S. Фостер, «Введение в химию белков», John Wiley & Sons, Нью-Йорк, 1957.

    Google ученый

  • Что такое белок? — Определение, функции, преимущества и источники — Видео и стенограмма урока

    Аминокислоты и белки

    Белки представляют собой длинные цепи из аминокислот . Аминокислоты — это строительные блоки белка. Другими словами, аминокислоты подобны звеньям в цепи. Сама цепочка представляет собой молекулу белка. Затем белковые цепи скручиваются и складываются определенным образом, чтобы создать определенные молекулы.

    В этом примере показана наша первичная белковая цепь, которая скручена в спиральную форму, свернута в лист, а затем снова скручена в замысловатую глобулярную форму. В этом случае конечным продуктом является молекула белка, известная как гемоглобин, которую можно найти в вашей крови.

    Источники белка

    Ранее мы упоминали, что белок играет роль в восстановлении тканей, и поэтому так важно иметь белок в вашем рационе.Но каковы лучшие источники белка? И есть ли разные типы протеина? Давайте исследуем эти вопросы. После этого вы можете заглянуть в свой холодильник и решить, является ли ваша диета богатой или бедной белками.

    Белок содержится во всем живом. Тип и количество белка в продуктах питания может быть разным, но неизбежно в той или иной форме. Мясо, сыры и орехи, как правило, содержат больше белка, чем многие растительные источники. Чтобы определить содержание белка в пище, нам нужно прочитать этикетку с пищевой добавкой.

    Согласно этикетке на этикетке, этот источник питания содержит три грамма белка. По сравнению с большинством продуктов, три грамма белка — это не так много. И эта этикетка не сообщает нам, является ли белок полным или неполным. Полноценные белки обычно получают из животных источников и содержат все аминокислоты, необходимые для создания белка в организме. Растительные источники, как правило, содержат меньше этих необходимых аминокислот; в результате они считаются неполными белками .

    Краткое содержание урока

    Белок используется для восстановления тканей, а также в качестве ферментов, антител и гормонов-посредников. Белки состоят из длинных цепочек из аминокислот . Аминокислоты — это субъединицы или звенья, составляющие белковую цепь. Все белковые молекулы построены из этих субъединиц. Однако конкретная форма белковой молекулы определяется ее функцией. Белок является одной из четырех макромолекул . Макромолекулы — это большие молекулы в вашем теле, которые выполняют определенные функции.

    Белки Ключевые термины

    • Белок : длинные цепи аминокислот
    • Аминокислоты : строительные блоки белка
    • Макромолекулы большие молекулы со специальными функциями
    • Полные белки : белки животного происхождения и содержат аминокислоты, необходимые для создания белков
    • Неполные белки : белки растительного происхождения

    Результаты обучения

    Примените полученные знания о белках при проверке своих способностей для достижения этих целей:

    • Обсудите различные варианты использования белков в организме человека
    • Подчеркнуть потребность в аминокислотах
    • Перечислите несколько источников белка
    .

    Добавить комментарий

    Ваш адрес email не будет опубликован. Обязательные поля помечены *