Примеры функции белков: Дети и учеба — Информационный портал

Содержание

Строение и функции белков — задания

  
Вернуться к теме «Строение и функции белков»

Задания по теме «Строение и функции белков» для самостоятельной подготовки к ЕГЭ по биологии

СКОРО! — Видео с объяснениями — СКОРО!

1. Установите со­от­вет­ствие между ха­рак­те­ри­сти­кой хи­ми­че­ско­го ве­ще­ства и ве­ще­ством в ор­га­низ­ме человека

ФУНКЦИИ ВЕ­ЩЕСТВ

 

ХИМИЧЕСКИЕ ВЕЩЕСТВА

А) спе­ци­фич­ные ка­та­ли­за­то­ры химических реакций

Б) пред­став­ле­ны толь­ко белками

В) бы­ва­ют бел­ко­вой и ли­пид­ной природы

Г) необходимы для нор­маль­но­го обмена веществ

Д) вы­де­ля­ют­ся не­по­сред­ствен­но в кровь

Е) в ос­нов­ном по­сту­па­ют вме­сте с пищей

 

1) ферменты

2) гормоны

3) витамины

 

2. Выберите примеры функций белков, осуществляемых ими на клеточном уровне жизни

1) обеспечивают транспорт ионов через мембрану

2) входят в состав волос, перьев

3) формируют кожные покровы

4) антитела связывают антигены

5) запасают кислород в мышцах

6) обеспечивают работу веретена деления

 

3. Выберите осо­бен­но­сти стро­е­ния мо­ле­кул белков

1) со­сто­ят из жир­ных кислот

2) со­сто­ят из аминокислот

3) мо­но­ме­ры мо­ле­ку­лы удер­жи­ва­ют­ся пеп­тид­ны­ми связями

4) со­сто­ят из оди­на­ко­вых по стро­е­нию мономеров

5) пред­став­ля­ют собой мно­го­атом­ные спирты

6) чет­вер­тич­ная струк­ту­ра мо­ле­кул со­сто­ит из не­сколь­ких глобул

 

4. Выберите три функции, ха­рак­тер­ные толь­ко для белков

1) энергетическая

2) каталитическая

3) двигательная

4) транспортная

5) структурная

6) запасающая

 

5. Все приведённые ниже признаки, кроме двух, можно использовать для описания значения белков в организме человека и животных. Определите два признака, «выпадающих» из общего списка, и запишите в ответ цифры, под которыми они указаны

1) служат основным строительным материалом

2) расщепляются в кишечнике до глицерина и жирных кислот

3) образуются из аминокислот

4) в печени превращаются в гликоген

5) в качестве ферментов ускоряют химические реакции

 

6. Все перечисленные ниже признаки, кроме двух, можно использовать для описания молекулы инсулина. Определите два признака, «выпадающие» из общего списка, и запишите в таблицу цифры, под которыми они указаны

1) состоит из аминокислот

2) гормон надпочечников

3) катализатор многих химических реакций

4) гормон поджелудочной железы

5) вещество белковой природы

 

7. Все перечисленные ниже признаки, кроме двух, можно использовать для описания яичного белка альбумина. Определите два признака, «выпадающих» из общего списка, и запишите в таблицу цифры, под которыми они указаны

1) состоит из аминокислот

2) пищеварительный фермент

3) денатурирует обратимо при варке яйца

4) мономеры связаны пептидными связями

5) молекула образует первичную, вторичную и третичную структуры

 

8. Белки в организме человека и животных

1) служат основным строительным материалом

2) расщепляются в кишечнике до глицерина и жирных кислот

3) образуются из аминокислот

4) в печени превращаются в гликоген

5) откладываются в запас

6) в качестве ферментов ускоряют химические реакции

 

9. Установите соответствие между характеристикой и функцией белка, которую он выполняет

ХАРАКТЕРИСТИКА БЕЛКА

 

ФУНКЦИЯ БЕЛКА

А) входит в состав центриолей

Б) образует рибосомы

В) представляет собой гормон

Г) формирует мембраны клеток

Д) изменяет активность генов

 

1) регуляторная

2) структурная

 

 

10. Найдите ошибки в приведенном тексте, исправьте их. Укажите номера пред-ложений, в которых сделаны ошибки, объясните их

1. Большое значение в строении и жизнедеятельности организмов имеют белки. 2. Это биополимеры, мономерами которых являются азотистые основания. 3. Белки входят в состав плазматической мембраны. 4. Многие белки выполняют в клетке ферментативную функцию. 5. В молекулах белка зашифрована наследственная информация о признаках организма. 6. Молекулы белка и тРНК входят в состав рибосом.

 

 

11. Какова природа большинства ферментов и почему они теряют свою активность при повышении уровня радиации?

 

 

12. Почему человек без опасных последствий употребляет в пищу белки в виде мяса, рыбы, яиц, а вводить белки сразу в кровь для питания больных ни в коем случае нельзя?

 

 

13. Может ли человек питаться только жирами, исключив из рациона белковую пищу?

 

 

14. Почему повышение температуры выше 40° опасно для жизни?

 

 

 

§4. Свойства и функции белков

 

1. Как называется процесс нарушения природной структуры белка, при котором сохраняется его первичная структура? Действие каких факторов может приводить к нарушению структуры белковых молекул?

Процесс нарушения природной структуры белков под влиянием каких-либо факторов без разрушения первичной структуры называется денатурацией. Денатурация белков может быть вызвана действием различных факторов, например, высокой температуры, концентрированных кислот и щелочей, тяжёлых металлов.

 

2. Чем фибриллярные белки отличаются от глобулярных? Приведите примеры фибриллярных и глобулярных белков.

Молекулы фибриллярных белков имеют вытянутую, нитевидную форму. Глобулярные белки характеризуются компактной округлой формой молекул. К фибриллярным белкам относятся, например, кератин, коллаген, миозин. Глобулярными белками являются глобулины и альбумины крови, фибриноген, гемоглобин и др.

 

3. Назовите основные биологические функции белков, приведите соответствующие примеры.

● Структурная функция. Белки входят в состав всех клеток и межклеточного вещества, являются компонентами различных структур живых организмов. Например, у животных белок коллаген входит в состав хрящей и сухожилий, эластин – в состав связок и стенок кровеносных сосудов, кератин является важнейшим структурным компонентом перьев, волос, ногтей, когтей, рогов, копыт.

● Ферментативная (каталитическая) функция. Белки-ферменты являются биологическими катализаторами, ускоряя протекание химических реакций в живых организмах. Например, пищеварительные ферменты амилаза и мальтаза расщепляют сложные углеводы до простых, пепсин – белки до пептидов, под действием липаз происходит расщепление жиров до глицерина и карбоновых кислот.

● Транспортная функция. Многие белки способны присоединять и переносить различные вещества. Например, гемоглобин связывает и переносит кислород и углекислый газ. Альбумины крови транспортируют высшие карбоновые кислоты, а глобулины – ионы металлов и гормоны. Многие белки, входящие в состав цитоплазматической мембраны, участвуют в транспорте веществ в клетку и из неё.

● Сократительная (двигательная) функция. Сократительные белки обеспечивают способность клеток, тканей, органов и целых организмов изменять форму, двигаться. Например, актин и миозин обеспечивают работу мышц и немышечные внутриклеточные сокращения, тубулин входит в состав микротрубочек веретена деления, ресничек и жгутиков эукариотических клеток.

● Регуляторная функция. Некоторые белки и пептиды участвуют в регуляции различных физиологических процессов. Например, гормоны белково-пептидной природы инсулин и глюкагон регулируют содержание глюкозы в крови, а соматотропин (гормон роста) – процессы роста и физического развития.

● Сигнальная функция заключается в том, что некоторые белки, входящие в состав цитоплазматической мембраны клеток, в ответ на действие внешних факторов изменяют свою пространственную конфигурацию, тем самым обеспечивая приём сигналов из внешней среды и передачу информации в клетку.

Например, белок опсин, входящий в состав пигмента родопсина, воспринимает свет и обеспечивает возникновение зрительного возбуждения рецепторов (палочек) сетчатки глаза.

● Защитная функция. Белки предохраняют организм от вторжения чужеродных объектов и от повреждений. Например, иммуноглобулины (антитела) участвуют в иммунном ответе, интерферон защищает организм от вирусной инфекции. Фибриноген, тромбопластин и тромбин обеспечивают свёртывание крови, предотвращая кровопотерю.

● Токсическая функция. Многие живые организмы выделяют белки-токсины, которые являются ядами для других организмов.

● Энергетическая функция. После расщепления до аминокислот белки могут служить источником энергии в клетке. При полном окислении 1 г белка выделяется 17,6 кДж энергии.

● Запасающая функция. Например, в семенах растений запасаются особые белки, которые используются при прорастании зародышем, а затем и проростком в качестве источника азота.

 

4. Что такое ферменты? Почему без их участия протекание большинства биохимических процессов в клетке было бы невозможным?

Ферменты – белки, которые выполняют функцию биологических катализаторов, т. е. ускоряют протекание химических реакций в живых организмах. Они катализируют реакции синтеза и расщепления различных веществ. Без участия ферментов эти процессы протекали бы слишком медленно или не протекали бы вовсе. Практически все процессы жизнедеятельности организмов обусловлены ферментативными реакциями.

 

5. В чем заключается специфичность ферментов? Какова её причина? Почему ферменты активно функционируют лишь в определённом диапазоне температуры, рН и других факторов?

Специфичность ферментов заключается в том, что каждый фермент ускоряет только одну реакцию либо действует только на определённый тип связи. Эта особенность объясняется соответствием пространственной конфигурации активного центра фермента тому или иному субстрату (субстратам).

Ферменты являются белками. Изменение рН, температуры и других факторов может вызвать денатурацию ферментов, в результате чего они теряют способность связываться со своими субстратами.

 

6. Почему белки, как правило, используются в качестве источников энергии лишь в крайних случаях, когда в клетках исчерпаны запасы углеводов и жиров?

Белки – основа жизни. Они выполняют чрезвычайно важные биологические функции, многие из которых (ферментативную, транспортную, двигательную и др.) не способны выполнять ни углеводы, ни жиры. Белки, использованные в качестве энергетического субстрата, дают столько же энергии, сколько и углеводы (1 г – 17,6 кДж) и в 2,2 раза меньше, чем жиры (1 г – около 39 кДж). Кроме того, при полном расщеплении белков (в отличие от углеводов и жиров) образуются не только СО2 и Н2О, но также соединения азота и серы, причём некоторые из них токсичны для организма (например, NH3). Поэтому энергетическую функцию у живых организмов выполняют прежде всего углеводы и жиры.

 

7*. У многих бактерий в процессах синтеза веществ, необходимых для нормального роста и размножения, участвует парааминобензойная кислота (ПАБК). В то же время в медицине для лечения ряда бактериальных инфекций используются сульфаниламиды — вещества, по структуре сходные с ПАБК. Как вы думаете, на чём основано лечебное действие сульфаниламидов?

С помощью фермента (дигидроптероатсинтетазы) бактерии осуществляют превращение ПАБК в продукт (дигидроптероевую кислоту), который далее используется для синтеза необходимых ростовых факторов. Из-за структурного сходства с ПАБК, сульфаниламиды также способны связываться с активным центром этого фермента, блокируя его работу (т.е. наблюдается конкурентное ингибирование). Это ведёт к нарушению синтеза ростовых факторов и нуклеиновых кислот у бактерий.

* Задания, отмеченные звёздочкой, предполагают выдвижение учащимися различных гипотез. Поэтому при выставлении отметки учителю следует ориентироваться не только на ответ, приведённый здесь, а принимать во внимание каждую гипотезу, оценивая биологическое мышление учащихся, логику их рассуждений, оригинальность идей и т. д. После этого целесообразно ознакомить учащихся с приведённым ответом.

Дашков М.Л.

Сайт: dashkov.by

Вернуться к оглавлению

 

< Предыдущая   Следующая >

Вопросы к экзамену за 10 класс

Список вопросов для экзамена по биологии для 10 класса АГ

Общая биология. Введение

  1. Коренные свойства живого. Уровни изучения живых систем.

    Биология клетки

    1.   Основные положения клеточной теории. Отличия про- и эукариотической клетки.

    2.   Химический и элементный состав живого: органогены, макро- и микроэлементы.

    3.   Функции воды и других минеральных веществ в живых организмах.

    4.   Липиды: классификация состав и функции. 

    5.   Жирные кислоты, их классификация и номенклатура.Триглицериды и воска: химический состав и биологические функции.

    6.   Структурные липиды (фосфоглицериды, сфинголипиды и гликолипиды): химический состав и биологические функции.

    7.   Углеводы: моно- ди- и олигосахариды. Структура и функции в клетке

    8.   Углеводы: полисахариды. Структура и функции в клетке

    9.   Аминокислоты. Классификация. Функции в живых организмах

    10.       Белки. Устройство пептидной связи. Механизм образования пептидной связи. Первичная структура белков. Вторичная. Факторы, определяющие определяющие вторичную структуру белка. Белковые домены.

    11.       Третичная и четвертичная структура белка. Факторы определяющие образование данных структур. Фолдинг/укладка белка. Денатурация и ренатурация белка.

    12.       Белки: классификация.  Функции белков. Примеры для растений, животных, бактерий.

    13.       Классификация и номенклатура ферментов.Структурные особенности белков-ферментов. Функциональные компоненты ферментативных систем. Понятие активного центра. Структура и свойства активных центров ферментов.

    14.       Физико-химические основы ферментативного катализа. Влияние факторов среды (температура, рН, ионная сила) на скорость ферментативных реакций. Принципы регуляции ферментативной активности.

    15.       Структра и номенклатура нуклеотидов. Функции нуклеотдиов.

    16.       Нуклеиновые кислоты: типы, строение и функции. 

    17.       Структура ДНК. Репликация ДНК

    18.       Типы, строение и функции РНК в клетке

    19.       Транскрипция: процессинг РНК. 

    20.       Ген, генетический код. 

    21.       Синтез белка: трансляция. Структура и функции рибосом. Регуляция трансляции

    22.       Регуляция экспрессии генов  эукариот и прокариот. Оперон.

    23.       Пигменты. Химическое строение и функции в клетке. 

    24.       Строение прокариотической клетки.

    25.       Эукариотическая клетка. Строение и функции ядра, цитоплазмы и основных органоидов.

    26.       Сравнительная характеристика клеток эукарит: грибов, растений и животных.

    27.       Фазы клеточного цикла.

    28.       Этапы и значение митоза.

    29.       Этапы и значение мейоза 

    30.       Метаболизм. Ассимиляция и диссимиляция. 

    31.       Типы питания.

    32.       Хемосинтез у прокариот. Реакции брожения. 

    33.       Клеточное дыхание. Строение и функции митохондрий.

    34.       Гликолиз

    35.       Цикл Кребса

    36.       Электрон-транспортная цепь. Синтез АТФ.

    37.       Фотосинтез. Строение и функции хлоропластов. 

    38.       Световая фаза. Z-схема. Синтез АТФ и восстановление НАДФ.

    39.       Темновая фаза. Цикл Кальвина

    40.        С4 путь. CAM-метаболизм.

    Экология

    1.    Экологические факторы. Определение, классификация и принципы действия.

    2.    Среды жизни. Классификация, общие свойства.

    3.    Популяция, определение. Плотность, рождаемость, смертность. Возрастная структура

    4.    Ограниченный и неограниченный рост численности. Уравнение Ферхюльста-Пирла.

    5.    Структура экосистемы. Поток энергии и круговорот вещества. Цепи и сети питания. Экологическая пирамида.

    6.    Понятие о продуцентах, консументах и редуцентах. Систематическое положение и основные процессы преобразования вещества и энергии реализуемые ими.

    7.    Типы экосистем и их стабильность. Первичная и вторичная продукция.

    8.    Особенности функционирования искусственных экосистем.

    9.    Взаимодействия организмов в экосистемах. Классификация.

    10.  Взаимодействия хищник-жертва.

    11.  Взаимоотношения паразит-хозяин, примеры систем из разных царств органического мира. Основные адаптации к жизни в организме хозяина.

    12.  Конкуренция. Типы и механизмы конкурентных взаимоотношений. Принцип Гаузе.

    13.  Особенности водной среды обитания. Положение организмов по отношению к действию основных экологических факторов в водной среде.

    14.  Особенности наземно-воздушной среды обитания. Положение организмов по отношению к действию основных экологических факторов в наземно-воздушной среде.

    15. Освоение растениями и животными наземно-воздушной среды.

    16. Основные таксоны животных, обитающих в пресных водах. Первично- и вторичноводные животные.

    17. Организмы – вредители древесных пород: основные таксоны и их биологические особенности.

    Микробиология

    1. Строение клетки эукариот и прокариот. Сравнительная характеристика.

    2. Общая характеристика прокариот. Бактерии и археи. Строение клетки, размножение. Спорообразование.

    3. Роль прокариот в природе и жизни человека. Болезнетворные бактерии.

    4. Основные пути преобразования вещества и получения энергии у прокариот.

    Альгология

    1. Общая характеристика экологической группы водорослей (фотоавтотрофных протистов). Типы строения вегетативного тела.

    2. Размножение и жизненные циклы водорослей.

    3. Отдел Зеленые водоросли, общая характеристика, основные представители. Жизненный цикл Улотрикса, Ульвы и Хламидомонады.

    4. Отдел Бурые водоросли, общая характеристика, основные представители. Жизненный цикл Ламинарии и Ектокарпуса.

    5. Водоросли вне водных местообитаний

    Микология

    1. Роль грибов в природе, эволюция и строение вегетативного тела.

    2. Размножение и жизненные циклы базидиальных и сумчатых грибов, основные представители.

    3. Формы и эволюция плодовых тел базидиальных и сумчатых грибов.

    4. Лишайники. Строение вегетативного тела, размножение, жизненные формы.

    5. Экологические группы грибов

    Ботаника

    1. Происхождение и общая характеристика высших растений

    2. Жизненный цикл высших растений. Две линии эволюции высших растений с преобладанием гаметофита и спорофита.

    3. Переход от равно- к разноспоровости как важный этап эволюции высших растений.

    4. Эволюция женского гаметофита у высших растений.

    5. Отдел Bryophyta (Мохообразные): общая характеристика, происхождение и жиз­нен­ный цикл, роль в природе.

    6. Отдел Rhyniophyta (Риниофиты). Про­исхождение. Строение основных предста­вителей. Отдел Equisetophyta (Членистостебельные, Хвощеобразные). Общая характеристика.

    7. Отдел Lycopodiophyta (Плауновидные): общая характеристика.

    8. Отдел Equisetophyta (Членистостебельные, Хвощеобразные): общая характеристика.

    9. Отдел. Polypodiophyta (папоротникообразные). Общая характеристика.

    10.Происхождение голосеменных растений (возникновение семезачатка).

    11. Общая характеристика класса хвойных, основные представители, жизненный цикл сосны обыкновенной

    12.Общая характеристика цветковых растений, деление на классы.

    13. ABC модель закладки цветка Основные направления эволюции цветка двудольных и однодольных растений.

    14.Развитие мужского гаметофита у голосеменных и цветковых растений.

    15.Формы опыления, специализация к агенты опыления.

    16.Видоизменение (метаморфоз) органов растений.

    17.Жизненные формы цветковых растений

    18.Ткани цветковых растений. Классификация, строение.

    19.Плоды и семена, принципы классификации, специализация к агенту распространения.

    Зоология беспозвоночных. Часть 1

    1. Место царства Животные в системе живой природы.
    2. Общая характеристика простейших животных (Protozoa). Простейшие как целостный организм. Кто такие «Протисты»?
    3. Скелетные образования и способы локомоции простейших.
    4. Питание, газообмен, выделение и осморегуляция у простейших.
    5. Общая характеристика и сравнительный анализ Саркодовых (Sarcodina).
    6. Общая характеристика жгутиконосцев (Mastiogophora). Euglenida как представители миксотрофных простейших.
    7. Общая характеристика и основные особенности Инфузорий (Ciliophora).
    8. Малярийный плазмодий: систематическое положение, жизненный цикл и значение для человека.
    9. Особенности паразитических простейших, связанные с их образом жизни.
    10. Теория симбиогенетического происхождения хлоропластов и митохондрий.
    11. Особенности многоклеточных животных (Metazoa), их происхождение.
    12. Особенности строения и функционирования губок (тип Spongia). Место губок в системе многоклеточных животных.
    13. Особенности строения и функционирования пластинчатых (тип Placozoa), их место в системе многоклеточных животных.
    14. Основные этапы раннего онтогенеза многоклеточных животных. Понятие зародышевого листка. Двуслойные и трехслойные животные. Способы закладки мезодермы. Первично- и вторичноротые животные.
    15. Строение и жизненные циклы кишечнополостных (тип Cnidaria). Одиночные и колониальные кишечнополостные. Особенности поколения полипов и медуз, связанные с их образом жизни.
    16. Основные черты строения и функционирования плоских червей (тип Plathelminthes).
    17. Сосальщики (Trematoda) как паразитические плоские черви. Жизненный цикл сосальщиков.
    18. Ленточные черви (Cestoda) – паразиты человека и других животных: особенности строения и жизненных циклов.
    19. Общая характеристика круглых червей (тип Nematoda).
    20. Общая характеристика кольчатых червей (тип Annelida). Понятие метамерии.
    21. Общая характеристика членистоногих (тип Arthropoda). Основные таксоны членистоногих.
    22. Внешнее строение и особенности сегментного состава тела насекомых.
    23. Основные отряды насекомых с неполным и полным превращением: особенности строения, образа жизни и онтогенеза.
    24. Особенности общественных насекомых на примере муравьев (отр. Перепончатокрылые, сем. Муравьи).
    25. Способ локомоции, типы скелета и организация мускулатуры у многоклеточных животных.
    26. Особенности паразитических многоклеточных животных, связанные с образом жизни.
    27. Способы заражения хозяев паразитами. Приведите примеры соответствующих организмов с указанием их систематической принадлежности.
    28. Перед Вами препарат (тотальный препарат, гистологический срез и пр.) некоторого животного. Определите его систематическое положение и охарактеризуйте основные признаки.

    Каталитическая функция белков: примеры. Основные функции белков

    Белки представляют собой природные органические соединения, которые обладают высокомолекулярным строением. Молекула данных веществ является неразветвляющимся полимером. Белки построены из 20 аминокислот. Именно они представляют структурную минимальную единицу молекулы – мономер. Все составляющие белка соединены между собой полипептидной, по-другому — карбамидной, связью в достаточно длинные цепи. При этом молекулярная масса может составлять от нескольких тысяч и до миллионов атомных частиц.

    Каким может быть белок

    Чтобы определить основные функции белка, стоит разобраться в строении подобных веществ. На данный момент существует две разновидности этого важного для человека компонента: фибриллярные и глобулярные. Различают их в основном благодаря разнице в строении белковой молекулы.

    Глобулярное вещество прекрасно растворяется не только в воде, но и в солевых растворах. При этом молекула такого белка обладает шарообразной формой. Такую хорошую растворимость можно легко объяснить расположением заряженных остатков аминокислот, которые окружены гидратной оболочкой, на поверхности глобулы. Именно это и обеспечивает такие хорошие контакты с различными растворителями. Стоит отметить, что в группу глобулярных компонентов входят все ферменты, а также практически все биологически активные белки.

    Что касается фибриллярных веществ, то их молекулы обладают волокнистой структурой. Каталитическая функция белков очень важна. Поэтому сложно представить ее выполнение без вспомогательных веществ. Фибриллярные белки не растворяются ни в солевых растворах, ни в обычной воде. Их молекулы располагаются параллельно в полипептидных цепях. Такие вещества участвуют в процессах образования некоторых структурных элементов соединительных тканей. Это эластины, кератины, коллагены.

    Особую группу составляют сложные белки, которые состоят не только из аминокислот, но и нуклеиновых кислот, углеводов и прочих веществ. Все эти компоненты играют особую роль. Особое значение имеет каталитическая функция белков. Помимо этого, вещества подобного плана являются дыхательными пигментами, гормонами, а также надежной защитой для любого организма. Биосинтез белка осуществляется на рибосомах. Этот процесс определяется при трансляции кодом нуклеиновых кислот.

    Каталитическая функция белков

    Катализ разнообразных химических веществ – это самая главная функция белков. Подобные процессы осуществляются ферментами. Это белки, которые обладают каталитическими специфическими свойствами. Каждый из подобных веществ может осуществлять одну или же несколько похожих реакций. Катализируют ферменты процесс расщепления сложных молекул, а также их синтез. По-другому эти реакции называют катаболизмом и анаболизмом. Каталитическая функция белков подразумевает также репарацию и репликацию ДНК, а также матричный синтез РНК.

    Что такое катализ

    Уже к 2013 году учеными было выявлено чуть более 5 тысяч ферментов. Подобные вещества способны влиять на ход практически любых биохимических реакций. Чтобы стала более понятной каталитическая функция белков, стоит разобраться, что же такое катализ. С греческого языка это понятие переводится как «прекращение». Катализ представляет собой изменение скорости протекания любой химической реакции. Происходит это под действием определенных соединений. Ферментами выполняется каталитическая функция белков. Примеры этого явления встречаются в повседневной жизни постоянно. Просто человек этого не замечает.

    Пример каталитической функции

    Чтобы понять, как действуют ферменты, стоит рассмотреть несколько примеров. Итак, в чем заключается каталитическая функция белков. Примеры:

    1. При фотосинтезе рибулезобифосфаткарбоксилаза осуществляет катализ фиксации СО2.
    2. Перекись водорода расщепляется до кислорода и воды.
    3. ДНК синтезирует ДНК-полимераза.
    4. Амилаза способна расщепляет до мальтозы крахмал.
    5. Деградация угольной кислоты: СО2 + Н2О НСО3 + Н+.

    Каталитическая функция белков заключается в ускорении любых химических превращений. К подобным реакциям относится синтез, распад веществ, перенос отдельных атомов или электронов от одного компонента к другому.

    Транспортная функция

    Жизнедеятельность любой клетки должна поддерживаться различными веществами, которые являются для них не только строительным материалом, но и своеобразной энергией. Биологические функции белков включают и транспортную. Именно эти компоненты поставляют в клетки все важные вещества, ведь мембраны построены из нескольких слоев липидов. Именно здесь и находятся различные белки. При этом гидрофильные участки все сосредоточены на поверхности, а хвостики — в толще мембран. Такое строение не позволяет проникать внутрь клеток очень важным веществам – ионам щелочных металлов, аминокислотам и сахарам. Белки переносят все эти компоненты внутрь клеток для их питания. Например, гемоглобин транспортирует кислород.

    Рецепторная

    Основные функции белка обеспечивают не только питание клеток живых организмов, но и помогают распознать сигналы, которые поступают из внешней среды и соседних клеток. Самый яркий пример такого явления – рецепторы ацетилхолина, который расположен на мембране около межнейронных контактов. Сам процесс очень важен. Белки выполняют рецепторную функцию, их взаимодействие с ацетилхолином проявляется специфическим образом. В результате внутрь клетки передается сигнал. Однако спустя некоторое время нейромедиатор обязательно должен быть удален. Только в этом случае клетка сможет получить новый сигнал. Именно эту функцию выполняет один из ферментов – ацетилхолтнэстераза, который выполняет расщепление до холина и ацетата гидролизацетилхолина.

    Защитная

    Иммунная система любого живого существа способна отвечать на появление в организме чужеродных частиц. В данном случае срабатывает защитная функция белка. В организме происходит выработка большого количества лимфоцитов, которые способны наносить вред патогенным бактериям, макромолекулам, раковым клеткам и прочее. Одна из групп данных веществ осуществляет выработку особых белков — иммуноглобулинов. Происходит выделение данных веществ в кровеносную систему. Иммуноглобулины распознают чужеродные частицы и образуют высоко специфический комплекс определенной стадии уничтожения. Так осуществляется защитная функция белка.

    Структурная

    Функции белка в клетке протекают незаметно для человека. Некоторые вещества имеют по большей части структурное значение. Подобные белки обеспечивают механическую прочность отдельных тканей в организмах. Прежде всего, это коллаген. Это основной компонент внеклеточного матрикса всех соединительных тканей в живом организме.

    Стоит отметить, что у млекопитающих коллаген составляет примерно 25 % от общей массы белков. Синтез данного компонента происходит в фибробластах. Это основные клетки любой соединительной ткани. Первоначально образуется проколлаген. Это вещество является предшественником и проходит химическую обработку, которая состоит в окислении до гидроксипролина остатков пролина, а также до гидрксилина остатков лизина. Коллаген образуется в виде трех пептидных цепей, скрученных в спираль.

    Это не все функции белков. Биология — достаточно сложная наука, которая позволяет определить и распознать множество явлений, протекающих в организме человека. Каждая функция белка играет особую роль. Так, в эластичных тканях, например в легких, стенках кровеносных сосудов и коже имеется эластин. Этот белок способен растягиваться, а затем возвращаться к исходной форме.

    Двигательные белки

    Мышечные сокращения – это процесс, при котором происходит превращение энергии, запасенной в молекулах АТФ в виде пирофосфатных макроэргических связей, именно в механическую работу. В данном случае функции белка в клетке выполняют миозин и актин. Каждый из них имеет свои особенности.

    Миозин обладает необычайным строением. Этот белок состоит из нитевидной достаточно длиной части – хвоста, а также из нескольких глобулярных головок. Выделяется миозин, как правило, в виде гексамера. Этот компонент образуется несколькими совершенно одинаковыми полипептидными цепями, каждая из которых обладает молекулярной массой в 200 тысяч, а также 4 цепями, молекулярная масса которых составляет всего 20 тысяч.

    Актин представляет собой глобулярный белок, который обладает способностью полимеризоваться. При этом вещество образует достаточно длинную структуру, которую принято называть F-актином. Только в таком состоянии компонент может нормально взаимодействовать с миозином.

    Примеры основных функций белков

    Ежесекундно в клетках живого организма протекают всевозможные процессы, которые невозможны были бы без белков. Примером рецепторной функции подобных веществ может послужить сообщение клеткам адренорецептором о присоединении адреналина. Под воздействием света происходит разложение родопсина. Подобное явление запускает реакцию и возбуждает палочку.

    Что касается структурной функции, то лучшим примером в данном случае может послужить действие коллагена. Это вещество придает соединительным тканям больше упругости.

    Примером транспортной функции является перенос гемоглобином кислорода по всему живому организму.

    В заключение

    Это все основные биологические функции белков. Каждая из них очень важна для живого организма. При этом определенная функция выполняется соответствующим белком. Отсутствие подобных компонентов может привести к нарушению работы определенных органов и систем в организме.

    Шпаргалки для подготовки к ЕГЭ по биологии: примеры белков и их функций | Docendo discimus

    Инсулин

    Инсулин

    Столкнулась с тем, что некоторые ученики, готовясь к экзамену, учат теорию, но не считают важным читать разные источники, дополнительно к основным учебникам. Это важно, так как начитанность расширяет кругозор, а кругозор позволяет ответить на более широкий спектр вопросов. Например, вы знаете уровни организации, но не в курсе кто такая кишечная палочка, и ответить на вопрос об уровне организации этой самой кишечной палочки уже будет сложно. Поэтому чем больше вы соотносите теоретические знания с реальными биологическими объектами, тем лучше. В этой статье приведу информацию по теме «Строение и функции белков». Не буду утомлять вас материалом, который вы можете найти в любом учебнике, в этой шпаргалке будут только примеры конкретных белков и их функций.

    Функции белков следующие: структурная, защитная, ферментативная, регуляторная, двигательная, транспортная. Примеры белков, выполняющих функции из этого списка приведены ниже.

    К структурным белкам можно отнести:

    Коллаген – белок фибриллярной структуры, который образует соединительную ткань животных, а значит из него состоит костный скелет, все хрящи, сухожилия. Коллаген обеспечивает прочность и эластичность. Коллаген есть только у многоклеточных животных и его нет у вирусов, бактерий, простейших и растений.

    Кератин – этот белок образует кожу, входит в состав волос, ногтей, перьев птиц. По структуре кератин — фибриллярный белок, его вторичная структура на 80% представлена α-спиралями и β-тяжами. Благодаря этой структуре и высокому содержанию цистеина, который образует дисульфидные мостики, кератин имеет высокую упругость. Например, волосы или шерсть восстанавливают свою форму после высыхания.

    Фиброин — белок, образуемый прядильными железами насекомых (пауков, личинок тутового и дубового шелкопряда). Фиброин представляет собой нерастворимый фибриллярный белок, который состоит из слоев антипараллельных бета — листов. Первичная структура его состоит из последовательности аминокислот Gly — Ser -Gly- Ала -Gly-Ала. Как видим, глицина в молекуле гораздо больше, кроме того молекула имеет регулярное строение, это обеспечивает плотную упаковку молекул в листы и способствует жесткой структуре шелка и прочности. Сочетание жесткости и прочности делает его материалом, находящим применение в нескольких областях, включая биомедицину и текстильное производство. Надо отметить, что паутина — уникальный биоматериал, который появился в ходе эволюции более 200 миллионов лет назад. При помещении в организм человека паутина не вызывает иммунного ответа и способна подавлять рост бактерий, и это свойство крайне интересует врачей и биоинженеров.

    Ферментативную функцию выполняют такие белки как:

    Пепсин желудочного сока – фермент класса гидролаз образуется из своего предшественника пепсиногена. Процесс выработки происходит в главных клетках слизистой оболочки желудка. Основная функция пепсина – он расщепляет белки пищи до пептидов. Пепсин был открыт еще в 19 веке Теодором Шванном, а 1930 голу его смог получить в лабораторных условиях Джон Нортроп. Пепсин действует только в кислой среде желудка, и при попадании в щелочную среду двенадцатиперстной кишки становится неактивным.

    Пепсин

    Пепсин

    Защитную функцию выполняют белки:

    Антитела (глобулин крови млекопитающих) – образуют комплексы с чужеродными белками. Это крупные глобулярные белки плазмы крови, выделяющиеся плазматическими клетками иммунной системы. Они необходимы для нейтрализации клеток бактерий, грибов, многоклеточных паразитов, попадающих в организм, а также вирусов и других чужеродных веществ. Глобулины имеют третичную структуру. Клетки иммунной системы начинают вырабатывать антитела в ответ на чужеродные белки – антигены. Антитела накапливаются в сыворотке крови и являются уникальными на каждый антиген.

    Фибриноген по международной номенклатуре – это фактор I (первый) свертывающей системы плазмы крови. Белок находится в плазме крови, превращающийся под воздействием тромбина в фибрин в процессе свертывания крови.

    Тромбин крови (фактор свёртывания II) — функцию свертывания крови в организме осуществляет сложная система, одним из компонентов которой является тромбин. Главная его функция — превращение фибриногена в фибрин. Он действует также на несколько других факторов свертывания.

    Яичный альбумин — это пример простого белка глобулярной структуры – основа для питания эмбриона, служит защитой для желтка, обладает бактерицидными свойствами. Этот белок выполняет запасающую (питательную) и защитную функцию.

    Регуляторную функцию выполняют гормоны, например инсулин.

    Инсулин – это гормон белковой природы, молекула инсулина образована двумя полипептидными цепями, образуя первичную структуру. Инсулин образуется в клетках островков Лангерганса поджелудочной железы. Основная функция инсулина – регуляция углеводного обмена.

    Снова инсулин

    Снова инсулин

    Дыхательный пигмент, транспорт:

    Гемоглобин – содержится в эритроцитах, обеспечивает красный цвет крови. Молекула имеет четвертичную структуру. Основной функциональной единицей является гем структура из пиррольных колец и атома железа. Гем связан с каждой из четырех субъединиц белковой молекулы. Именно за счет атома железа осуществляется главная функция гемоглобина – быстрое присоединение и последующее отщепление кислорода, т.е транспорт кислорода в ткани и органы. Перенос выдыхаемого СО2 также осуществляется гемоглобином, но за счет связывания углекислоты Nh3 группой белка.

    Миоглобин – так же как и гемоглобин, является дыхательным пигментом. Находится он в мышечной ткани. Молекула представляет собой одну полипептидную цепь, образующую третичную структуру. По структуре молекула миоглобина сходна с молекулой гемоглобина и это не случайно: особенность строения молекулы зависит от функции этих белков, а она у них одинакова – транспорт кислорода. Миоглобин транспортирует кислород в мышечной ткани. Особенность – быстро связываете кислород, но труднее, чем гемоглобин отдает его.

    Сократительные белки (двигательная функция):

    Миозин — состоит из двух переплетённых a-спиралей (фибриллярная часть), которые соединены с двумя глобулами. Фибриллярная часть выполняет сократительную функцию. Глобулярная– ферментативную функцию, и тем самым обеспечивает молекулу энергией, которая необходима для выполнения сократительных движений. Таким образом, белок образует подвижные нити миофибрилл саркомера.

    Актин – белок образует микрофиламенты — один из основных компонентов цитоскелета эукариотических клеток. Вместе с белком миозином образует основные сократительные элементы мышц — актомиозиновые комплексы саркомеров. Актин образует неподвижные нити миофибрилл саркомера.

    Есть еще немало примеров — пишите, что еще можно дополнить в мой список. Ну и не забывайте повторять материал, он есть в других шпаргалках — здесь, здесь и здесь.

    Можете написать в комментариях какую тему собрать в компактную шпаргалку, я обязательно учту ваше мнение!

    Если статья была полезной — не жалейте лайк. Подписывайтесь на канал — я вам рада помочь!

    Выберите примеры функций белков, осуществляемых ими на клеточном уровне жизни.

    Отложенные задания (30)

    Отложенные задания (30) Вставьте в текст «ДНК» пропущенные термины из предложенного перечня, используя для этого цифровые обозначения. Запишите в текст цифры выбранных ответов, а затем получившуюся последовательность

    Подробнее

    БЛОК 2 Клетка как биологическая система.

    1. К макроэлементам относятся: БЛОК 2 Клетка как биологическая система. 1) кислород, углерод, водород, азот 2) кислород, железо, золото 3) углерод, водород, бор 4) селен, азот, кислород 1) 2. Органоид,

    Подробнее

    в ответ цифры, под ко то ры ми они ука за ны.

    Метаболизм/Фотосинтез/Биосинтез/Энергетический обмен 1. Все приведённые ниже признаки, кроме двух, можно использовать для описания световой фазы фотосинтеза. Определите два признака, «выпадающих» из общего

    Подробнее

    ID_1064 1/5 neznaika.pro

    1 Клетка, её жизненный цикл (множественный выбор) Ответами к заданиям являются слово, словосочетание, число или последовательность слов, чисел. Запишите ответ без пробелов, запятых и других дополнительных

    Подробнее

    9 класс Биология П1 ПРОФИЛЬ.

    9 класс Биология П1 ПРОФИЛЬ. Мономером ДНК является: Задание 1 нуклеозид нуклеотид глюкоза аминокислота Задание 2 Вторичная структура каждой т-рнк имеет не сколько петель благодаря тому, что соседние с

    Подробнее

    Белки, их строение и функции

    2.3.3. Белки, их строение и функции Белки это биологические гетерополимеры, мономерами которых являются аминокислоты. Белки синтезируются в живых организмах и выполняют в них определенные функции. В состав

    Подробнее

    O, H, C, N + S, P — макроэлементы. Na, K, Mg, Ca, Cl — микроэлементы Fe, Zn, Cu, Co, Mn, I, Se следовые элементы

    O, H, C, N + S, P — макроэлементы Na, K, Mg, Ca, Cl — микроэлементы Fe, Zn, Cu, Co, Mn, I, Se следовые элементы Представленность макроэлементов в различных группах веществ Макромолекулы Сахара (углеводы)

    Подробнее

    10класс Биология погружение 3

    10класс Биология погружение 3 Тема: Энергетический обмен. 1. Наибольшее количество энергии освобождается при расщеплении молекул 1) белков 2) жиров 3) углеводов 4) нуклеиновых кислот 2. В бескислородной

    Подробнее

    ТЕМА «Энергетический обмен»

    1. К автотрофным организмам относят 1) мукор 2) дрожжи 3) пеницилл 4) хлореллу ТЕМА «Энергетический обмен» 2. В процессе пиноцитоза происходит поглощение 1) жидкости 2) газов 3) твердых веществ 4) комочков

    Подробнее

    Тема: Учение о клетке

    Государственное бюджетное образовательное учреждение среднего профессионального образования «Кущевский медицинский колледж» министерства здравоохранения Краснодарского края Задания в тестовой форме по

    Подробнее

    ID_2853 1/6 neznaika.pro

    1 Клетка, её жизненный цикл (установление соответствия) Ответами к заданиям являются слово, словосочетание, число или последовательность слов, чисел. Запишите ответ без пробелов, запятых и других дополнительных

    Подробнее

    Задания B6 по биологии

    Задания B6 по биологии 1. Установите соответствие между особенностями строения и свойств вещества и веществом, имеющим эти особенности. ОСОБЕННОСТИ СТРОЕНИЯ И СВОЙСТВ ВЕЩЕСТВА А) неполярны, нерастворимы

    Подробнее

    Объем составного многогранника

    Объем составного многогранника 1 Найдите объем многогранника, изоб ра жен но го на ри сун ке (все дву гран ные углы мно го гран ни ка прямые) объем многогранника, изоб ра жен но го на ри сун ке (все дву

    Подробнее

    Тема: «Нуклеиновые кислоты. ДНК»

    Глава I. Основы цитологии На дом: 12 Тема: «Нуклеиновые кислоты. ДНК» Задачи: Дать характеристику нуклеиновым кислотам: видам НК, локализации их в клетке, строению, функциям. Изменено, дополнено Нуклеиновые

    Подробнее

    Конкурсный открытый урок

    МИНИСТЕРСТВО ОБРАЗОВАНИЯ РБ ГАОУ СПО Нефтекамский нефтяной колледж Посвящается году охраны окружающей среды Конкурсный открытый урок На тему: Нуклеиновые кислоты Тема урока: Нуклеиновые кислоты Цели урока:

    Подробнее

    «Нуклеиновые кислоты»

    Государственное бюджетное общеобразовательное учреждение Самарской области средняя общеобразовательная школа 8 пгт Алексеевка городского округа Кинель Самарской области Методическая разработка урока биологии

    Подробнее

    Чтение графиков функций

    Чтение графиков функций 1. Найдите зна че ние по гра фи ку функции, изоб ра жен но му на рисунке. 1) 2) 3) 4) Абсцисса вер ши ны параболы равна 1, по это му от ку да Па ра бо ла пересекает ось ор ди нат

    Подробнее

    Химический состав живого

    Химический состав живого Единство химического состава С,Н,О,N 99% состава живых организмов (органогены) Р,S,Na, K,Ca, Cl,Mg обязательны (макроэлементы) Mn, Fe, Co, Cu, Zn обязательны в микродозах (микроэлементы)

    Подробнее

    Контрольная работа за 1 семестр

    Контрольная работа за 1 семестр 1. К неорганическим веществам клетки относятся 1) жиры 2) белки 3) нуклеиновые кислоты 4) вода 2. Глюкоза является мономером: 1) гемоглобина 2)глицерина 3) гликогена 4)

    Подробнее

    Физика белка | Научно-образовательный центр по нанотехнологиям МГУ

    IV курс, VII семестр, специализация «Наноструктуры биологической мембраны» (подгруппа НБ2).

    Финкельштейн Алексей Витальевич (дфмн, профессор, совместитель по факультету биоинжененрии, биоинформатики).

    42 часа.

    Данный курс посвящен физике белка, т.е. самым общим проблемам структуры, самоорганизации и функционирования белковых молекул. Изложены те физические идеи и, в частности, те элементы статистической физики и квантовой механики, которые необходимы для понимания студентами строения и функционирования белков.
    Курс знакомит студентов, преимущественно, с теорией связанных с белками физических проблем; при этом в нем и дан лишь необходимый минимум экспериментальных данных и методов. Говоря о конкретных белках, даются лишь важнейшие примеры.

    Программа

    Белки: предварительный обзор. Общее строение и основные функции белков. Первичная, вторичная, третичная, четвертичная структура белка. Глобулярные, фибриллярные и мембранные белки. Понятие о биосинтезе белка, о его сворачивании in vivo и in vitro. Пост-трансляционные модификации.
    Элементарные взаимодействия в белках и вокруг них. Стереохимия аминокислотных остатков. L- и D-аминокислотные остатки. Валентные связи и углы между ними. Вращение вокруг валентных связей (примеры). Пептидная группа. Транс- и цис-пролины. Вандерваальсово взаимодействие: притяжение на больших расстояниях, отталкивание на малых. Разрешенные конформации аминокислотного остатка (карты Рамачандрана для глицина, аланина, валина, пролина). Водородные связи. Их электрическая природа. Их энергия и геометрия в кристаллах. Разболтанность водородных связей в воде (как это показано на опыте?). Водородные связи в водном окружении имеют энтропийную природу. Гидрофобные взаимодействия (в чем их особенность проявляется на опыте?). Их связь с необходимостью насыщения водородных связей в воде. Гидрофобность и доступная воде неполярная поверхность. Гидрофобность аминокислот. Влияние окружения, в особенности водного, на электростатические взаимодействия. Электрическое поле у поверхности и внутри белка. Измерение электрических полей в белках при помощи белковой инженерии. Дисульфидные связи. Координационные связи. Энергия, энтропия, свободная энергия и химический потенциал. Связь температуры с изменением энергии и энтропии. Вероятности состояний с различной энергией и энтропией (распределение Больцмана-Гиббса). Конформационные превращения. Понятие о фазовом переходе первого рода (переходе «все-или-ничего») и о не-фазовых переходах. Кинетика преодоления свободно-энергетического барьера при конформационных превращениях. Понятие о теории абсолютных скоростей реакций. Влияние вязкости. Диффузия.
    Вторичная структура полипептидных цепей. Вторичная структура полипептидов. Спирали: 27, 310, α, poly(Pro) II. Антипараллельная и параллельная β-структура, β-изгибы. Методы экспериментального обнаружения вторичной структуры. Что такое «клубок»? Что такое «нативно-развернутые» белки?
    Теорема Ландау и не-фазовость перехода спираль-клубок. Размер кооперативного участка при переходе спираль-клубок. Стабильность α-спирали и β-структуры в воде. Скорость образования β-структуры (шпилек и листов) и α-спиралей.
    Пространственное строение белков. Фибриллы, сложенные из глобул и «истинно» фибриллярные белки; функции и периодичные первичные и вторичные структуры последних; примеры. Упаковка длинных α-спиралей и обширных β-листов. Белки, образующие матрикс; эластин. Амилоиды. Мембранные белки, особенности их строения и функции. Бактериородопсин, порин, фотосинтетический центр. Селективная проницаемость мембранных пор. Работа фотосинтетического центра. Понятие о туннельном эффекте. Глобулярные белки. Упрощенное представление структур белковых глобул; структурные классы. Аминокислотная последовательность определяет пространственную структуру, пространственная структура — функцию. Обратное — неверно. Строение β-белков: β-слои, их продольная и перпендикулярная укладка; β-призмы. Правопропеллерная скрученность β-листов. Примеры. Строение α-белков. Пучки и слои спиралей. Укладка -спиралей вокруг квазишарового ядра. Примеры. Плотная упаковка при контакте α-спиралей. Строение α/β-белков: параллельный β-слой, прикрытый α-спиралями (укладка Россманна) и α/β-цилиндр. Топология β-α-β субъединиц. Строение α+β белков. Примеры.
    Классификация структур белков. “Стандартные” третичные структуры (примеры). Отсутствие прямой связи архитектуры белка с его функцией (примеры). Есть ли эволюция белковых структур? Дупликация гена и специализация. Эволюция путем перемешивания доменов. Основные закономерности, наблюдаемые в структурах белковых глобул: наличие отдельно α- и отдельно β-слоев; редкость перекрывания петель; редкость параллельности соседних по цепи структурных сегментов; редкость левых β-α-β суперспиралей. Физические причины этих феноменов. Связь частоты встречаемости разнообразных структурных элементов в нативных глобулярных белках с собственной свободной энергией этих элементов. Примеры.
    Кооператвные переходы в белковых молекулах. Кооперативные переходы. Обратимость денатурации белков. Денатурация глобулярного белка — переход типа “все-или-ничего”. Критерий Вант-Гоффа для перехода “все-или-ничего”. Тепловая и холодовая денатурация, денатурация растворителем. Диаграмма фазовых состояний белковой молекулы. Как выглядит денатурированный белок? Клубок и расплавленная глобула. Почему денатурация глобулярного белка — переход типа «все-или-ничего»? Распад плотной упаковки ядра белка и раскрепощение боковых групп.
    Самоорганизация белка in vivo и in vitro. Вспомогательные механизмы при самоорганизации in vivo: ко-трансляционное сворачивание, шапероны, и т.д. Спонтанная самоорганизация возможна in vitro. Понятие о “парадоксе Левинталя”. Опыты по сворачиванию белка in vitro. Обнаружение метастабильных (накапливающихся) интермедиатов сворачивания многих белков. Расплавленная глобула — обычно (но не обязательно) наблюдаемый интермедиат сворачивания белка в нативных условиях. Одностадийное сворачивание малых белков. Теория переходных состояний. Ядро сворачивания нативной структуры белка. Его экспериментальное обнаружение in vitro методами белковой инженерии. Решение «парадокса Левинталя»: к стабильной структуре цепи автоматически ведет сеть быстрых путей сворачивания. Оценка времени сворачивания белка.
    Предсказание и дизайн белковых структур. Опознавание сходства пространственных структур белков по сходству их аминокислотных последовательностей. Попытки предсказания пространственных структур белков их аминокислотным последовательностям ab initio.
    Свойства аминокислотных остатков (примеры: аланин, глицин, пролин, валин). Неполярные и полярные боковые группы. Заряженные боковые группы. Предпочтительные места для включения тех или иных аминокислотных остатков во вторичную и в третичную структуру. Гидрофобные поверхности на вторичных структурах в белках. Белковая инженерия (с примерами) и дизайн (с примерами). Подтверждение теории переходного состояния в катализе методами белковой инженерии. Абзимы.
    Физические основы функционирования белков. Элементарные функции белков. Связывающие белки: ДНК-связывающие белки, иммуноглобины. Ферменты и катализ. Каталитический и субстрат-связывающий центры. Ингибирование. Кофакторы.
    Механизм ферментативного катализа (на примере сериновых протеаз). Переходные состояния и интермедиаты. Почему твердость белка важна для элементарной ферментативной функции? Сопряжение элементарных функций белка и гибкость его структуры. Индуцированное соответствие. Подвижность доменов белка. Доменная структура: киназы, дегидрогеназы. Когда белку нужна (и когда не нужна) гибкость? Аллостерическая регулировка функции белка. Гемоглобин и миоглобин. Понятие о механохимическом цикле. Пример: движение кинезина.

    Список литературы

    ОСНОВНАЯ
    1.Финкельштейн А. В., Птицын О. Б. Физика белка. М: Книжный дом «Университет», 2002 или 2005.
    2. Branden C., Tooze J. Introduction to Protein Structure. New York, London: Garland Publ., Inc., 1991, 1999..
    3. Фершт Э. Структура и механизм действия ферментов, гл. 1,8-12. М: Мир, 1980.
    4. Шульц Г. Е., Ширмер Р. Х. Принципы структурной организации белков. М: Мир, 1982.
    ДОПОЛНИТЕЛЬНАЯ
    1.Рубин А. Б. Биофизика. т. 1, гл. 7-14. М: Книжный дом «Университет», 1999.
    2. Волькенштейн М.В. Биофизика, гл.4,6. М: Наука, 1981.
    3. Кантор Ч., Шиммель П. Биофизическая химия, т. 1, гл. 2,5; т.3, гл. 17,20,21. М: Мир, 1982.
    4. Ленинджер А. Основы биохимии, в 3-х тт., гл. 4-8, 23,29. М: Мир, 1985.
    5. Страйер Л. Биохимия, в 3-х тт., гл. 1-9, 27, 33-34. М: Мир, 1984 (т.1) — 1985 (тт. 2-3).

    Программу составил д.ф.-м-н., проф. Финкельштейн А.В.

    Аннотированный список лекций

    Лекция 1. Введение. Основные функции белков. Аминокислотная последовательность определяет пространственную структуру, пространственная структура — функцию. Обратное — неверно. Глобулярные, фибриллярные и мембранные белки. Первичная, вторичная, третичная, четвертичная структура белка. Биосинтез белка; сворачивание белка in vivo и in vitro. Пост-трансляционные модификации.
    Лекция 2. Ковалентные взаимодействия в аминокислотных остатках. Стереохимия L-аминокислотных остатков. Валентные связи и углы между ними. Их колебания. Вращение вокруг валентных связей. Пептидная группа. Транс- и цис-пролины.
    Лекция 3. Вандерваальсовы взаимодействия в аминокислотных остатках. Вандерваальсово взаимодействие: притяжение на больших расстояниях, отталкивание на малых. Разрешенные конформации аминокислотного остатка (карты Рамачандрана для глицина, аланина, валина, пролина).
    Лекция 4. Физика водородных связей в водном окружении. Влияние водного окружения. Водородные связи. Их электрическая природа. Их энергия. Их геометрия в кристаллах. Разболтанность водородных связей в воде. Понятие об энтропии и свободной энергии. Водородные связи в белковой цепи замещают такие же связи этой цепи с водой; в результате водородные связи в белковой цепи приобретают — в водном окружении — энтропийную природу.
    Лекция 5 (сдвоенная). Элементы термодинамики. Элементы термодинамики. Свободная энергия и химический потенциал. Гидрофобные взаимодействия. Их связь с необходимостью насыщения водородных связей в воде. Доступная воде неполярная поверхность аминокислот и их гидрофобность.
    Лекция 6 (сдвоенная). Электростатические взаимодействия. Влияние водного окружения на электростатические взаимодействия. Электрическое поле у поверхности и внутри белка. Диэлектрическая проницаемость. Экранировка зарядов в солевых растворах. Измерение электрических полей в белках при помощи белковой инженерии. Дисульфидные связи. Координационные связи.
    Лекция 7. Вторичная структура белковых цепей. Вторичная структура полипептидов. Спирали: 27, 310, α, π, poly(Pro) II. Антипараллельная и параллельная β-структура. β-изгибы. Методы экспериментального обнаружения вторичной структуры.
    Лекция 8 (сдвоенная). Элементы статистической физики. Связь температуры с изменением энергии и энтропии. Вероятности состояний с различной энергией (распределение Больцмана-Гиббса). Статистическая сумма и ее связь со свободной энергией. Конформационные превращения. Понятие о фазовом переходе первого рода (переходе «все-или-ничего») и о не-фазовых переходах. Кинетика преодоления свободно-энергетического барьера при конформационных превращениях. Понятие о теории скоростей реакций. Параллельные и последовательные процессы. Характерные скорости диффузионных процессов.
    Лекция 9 (сдвоенная). Стабильность и скорость образования вторичных структур в полипептидах. Свободная энергия инициации и элонгации α-спирали. Теорема Ландау и не-фазовость перехода спираль-клубок. Размер кооперативного участка при переходе спираль-клубок. Стабильность α-спирали в воде. Стабильность β-структуры в воде. Скорость образования β-структуры и α-спирали. Что такое «клубок»?
    Лекция 10. Физические свойства аминокислотных остатков. Свойства боковых групп аминокислотных остатков. Включение аминокислотных остатков во вторичную структуру. Аланин, глицин, пролин, валин. Неполярные, короткие полярные и длинные полярные боковые группы. Заряженные боковые группы. Гидрофобные поверхности на вторичных структурах в белках.
    Лекция 11. Фибриллярные белки. Фибриллярные белки, их функции и их периодичные первичные и вторичные структуры; α-кератин, β-фиброин шелка, коллаген. Упаковка длинных α-спиралей и обширных β-листов. Белки, образующие матрикс; эластин. Генетические дефекты белков и болезни. Амилоиды.
    Лекция 12. Мембранные белки. Мембранные белки, особенности их строения и функции. Бактериородопсин, рецепторы и G-белки, порин, фотосинтетический центр. Селективная проницаемость мембранных пор. Работа фотосинтетического центра. Понятие о туннельном эффекте. Понятие об электронно-конформационном взаимодействии.
    Лекция 13. Строение глобулярных белков; часть I: α-белки. Глобулярные белки. Упрощенное представление структур белковых глобул; структурные классы. Строение β-белков: β-слои, их продольная и перпендикулярная упаковка. Преимущественная антипараллельность β-структуры в β-белках. Правопропеллерная скрученность β-листов. Топология β-белков.
    Лекция 14. Строение глобулярных белков; часть II: α-, α/β- и α+β-белки. Строение α-белков. Пучки и слои спиралей. Модель квазисферической глобулы из α-спиралей. Плотная упаковка при контакте α-спиралей. Строение α/β-белков: параллельный β-слой, прикрытый α-спиралями, и α/β-цилиндр. Топология β-α-β субъединиц. Строение α+β белков. Отсутствие прямой связи архитектуры белка с его функцией.
    Лекция 15. Физические принципы строения белковой глобулы. Классификация структур белков. Отсутствие наблюдаемой «макроэволюции» эволюции укладок белковых цепей — при наблюдаемой «микроэволюции» их структур. Дупликация гена и специализация. Эволюция путем перемешивания доменов. “Стандартные” третичные структуры. Типичность “квазислучайного” чередования аминокислот в первичных структурах глобулярных белков, контраст с периодическими первичными структурами фибриллярных белков и блочными — мембранных белков Физические принципы строения белковой глобулы. Основные закономерности, наблюдаемые в структурах белковых глобул: наличие отдельно α- и отдельно β-слоев; редкость перекрывания петель; редкость параллельности соседних по цепи структурных сегментов; редкость левых β-α-β суперспиралей. “Энергетические” и “энтропийные” дефекты редко встречающихся структур и связь этих “дефектов” с относительной редкостью аминокислотных последовательностей, стабилизирующих “дефектные” структуры. “Принцип множественности”.
    Лекция 16. Физический отбор белковых структур. Какую вторичную структуру можно ожидать для случайных и квази-случайных аминокислотных последовательностей? Доменное строение стабильных структур квази-случайных последовательностей наиболее вероятно. Квази-Больцмановская статистика мелких деталей белковых структур. Она возникает из физического отбора стабильных белковых структур. Влияние стабильности структурного элемента на строгость отбора первичных структур, не разрушающих пространственную структуру глобулярного белка, или: почему одни белковые структуры встречаются часто, а другие — редко? Какую структуру — α или β — следует чаще ожидать в центре большой глобулы? Связь “энтропийных” дефектов с “энергетическими”. Глобулярные белки возникли как “отобранные” случайные полипептиды? Отбор «белковоподобных» случайных последовательностей в белковой инженерии.
    Лекция 17 (сдвоенная). Термодинамические состояния белковых молекул. Денатурация белка. Нативно-развернутые белки.. Кооперативные переходы. Обратимость денатурации белков. Денатурация глобулярного белка — переход типа “все-или-ничего”. Критерий Вант-Гоффа для перехода “все-или-ничего”. Тепловая и холодовая денатурация. Диаграмма фазовых состояний белковой молекулы Как выглядит денатурированный белок? Клубок и расплавленная глобула. Неоднородность расплавленной глобулы. Отсутствие фазового перехода типа “все-или-ничего” при набухании “обычных” полимерных глобул.
    Лекция 18. Термодинамика кооперативных переходов в белковых молекулах. Почему денатурация глобулярного белка — переход типа «все-или-ничего»? Распад плотной упаковки ядра белка и раскрепощение боковых групп. Проникновение растворителя в денатурированный белок, разрушение расплавленной глобулы, постепенное разворачивание белковой цепи по мере увеличения силы растворителя. Энергетическая щель между нативной укладкой белковой цепи и прочими ее глобулярными укладками: основное физическое отличие белковой цепи от случайного сополимера. Различия в плавлении “отобранного” гетерополимера (с энергетической щелью) и случайного сополимера.
    Лекция 19. Кинетика кооперативных переходов в белковых молекулах, часть I. Образование структуры белка in vivo и in vitro. Вспомогательные механизмы при самоорганизации in vivo: ко-трансляционное сворачивание, шапероны, и т.д. Спонтанная самоорганизация возможна in vitro. “Парадокс Левинталя”. Опыты по сворачиванию белка в бесклеточных системах, а также – о разном понимании слов “in vitro”. Стадийный механизм самоорганизации белков. Обнаружение метастабильных (накапливающихся) интермедиатов сворачивания многих белков Расплавленная глобула — обычно (но не обязательно) наблюдаемый интермедиат сворачивания белка в нативных условиях. Простейшее (одностадийное) сворачивание некоторых белков — без каких-либо накапливающихся метастабильных интермедиатов. Самоорганизация мембранных белков.
    Лекция 20. Кинетика кооперативных переходов в белковых молекулах, часть II. Одностадийное сворачивание малых белков. Теория перехòдных состояний. Экспериментальный поиск и изучение нестабильных перехòдных состояний в сворачивании белка. Ядро сворачивания нативной структуры белка. Его экспериментальное обнаружение in vitro методами белковой инженерии. Нуклеационный механизм сворачивания белка.
    Лекция 21. Физика самоорганизации белка. Решение «парадокса Левинталя»: к стабильной структуре цепи автоматически ведет сеть быстрых путей сворачивания. Для этого необходимо только, чтобы между нативной укладкой цепи и прочими ее глобулярными укладками существовала бы заметная энергетическая щель. Обсуждение аномально медленного образования стабильной структуры в некоторых белках (серпины, прионы). Представление об “энергетических ландшафтах” белков. Белковые структуры: физика самоорганизации и естественный отбор самоорганизующихся цепей.
    Лекция 22. Предсказание и дизайн белковых структур, часть I: вторичная структура белков. Потребность в предсказании структур белков по их аминокислотным последовательностям. “Опознавание” белковых структур и функций по гомологии последовательностей. Профили первичных структур семейств белков. Ключевые районы и функциональные сайты белковых структур. Выделение стабильных структур пространственных белковой цепи. “Шаблоны” белковых структур. Мы всегда вынуждены судить о предсказываемой структуре белка только по части взаимодействий, действующих в его цепи. Результат: вероятностные предсказания. Взаимодействия, стабилизующие и разрушающие вторичную структуру полипептидов. Расчет вторичных структур не-глобулярных полипептидов. Предсказание вторичной структуры белков.
    Лекция 23. Предсказание и дизайн белковых структур, часть II: третичная структура белков. Представление о подходах к предсказанию пространственных структур белков по их аминокислотным последовательностям. Базы данных по структурам белков. Предсказание общей укладки цепи отдаленных гомологов понижает неопределенности в опознавании структур белков. Структурная геномика и протеомика. Биоинформатика. Белковая инженерия и дизайн. Первые успехи в конструировании белков.
    Лекция 24 (сдвоенная). Элементарные функции белков и структуры белков. Элементарные функции. Связывающие белки: ДНК-связывающие белки, иммуноглобины. Ферменты. Активный центр — “дефект” глобулярной структуры. Твердость белка важна для элементарной ферментативной функции. Каталитический и субстрат-связывающий центры. Ингибирование. Кофакторы. Многовалентные ионы. Механизм ферментативного катализа. Пример: сериновые протеазы. Теория перехòдного состояния в катализе и ее подтверждение методами белковой инженерии. Абзимы. Специфичность катализа. Узнавание “ключ-замок”.
    Лекция 25. Строение белков, имеющих сложные функции. Сочетание функций. Переход субстрата с одного на другой активный центр. “Двойное сито” повышает специфичность функции. Относительная независимость структуры белка от его элементарной ферментативной активности. Заметная связь структуры с окружением белка. Сопряжение элементарных функций белка и гибкость его структуры. Индуцированное соответствие. Подвижность доменов белка. Перемешивание доменов при эволюции белков. Доменная структура: киназы, дегидрогеназы. Аллостерия — взаимодействие активных центров. Аллостерическая регулировка функции белка. Аллостерия и четвертичная структура белка. Гемоглобин и миоглобин. Механизм мышечного сокращения. Кинезин.

    Промежуточная аттестация

    Коллоквиум. Обсуждаемые темы:
    Элементарные взаимодействия в белках и вокруг
    Вторичные структуры полипептидных цепей
    Пространственное строение белков
    Кооперативные переходы в белковых молекулах
    Предсказание и дизайн белковых структур
    Функционирование белков

    Список вопросов в билетах

    1. Первичная, вторичная, третичная, четвертичная структура белка. Глобулярные, фибриллярные и мембранные белки. Понятие о биосинтезе белка, о его сворачивании in vivo и in vitro и о пост-трансляционных модификациях.
    2. Стереохимия аминокислотных остатков. Валентные связи и углы между ними. Вращение вокруг валентных связей (примеры). Пептидная группа. Транс- и цис-пролины. Дисульфидные связи. Координационные связи.
    3. Вандерваальсово взаимодействие: притяжение на больших расстояниях, отталкивание на малых. Разрешенные конформации аминокислотного остатка (карты Рамачандрана для глицина, аланина, валина, пролина).
    4. Водородные связи. Их электрическая природа. Их энергия и геометрия в кристаллах. Разболтанность водородных связей в воде (как это показано на опыте?). Водородные связи в водном окружении имеют энтропийную природу.
    5. Гидрофобные взаимодействия (в чем их особенность проявляется на опыте?). Их связь с необходимостью насыщения водородных связей в воде. Гидрофобность и доступная воде неполярная поверхность. Гидрофобность аминокислот.
    6. Влияние окружения, в особенности водного, на электростатические взаимодействия. Электрическое поле у поверхности и внутри белка. Измерение электрических полей в белках при помощи белковой инженерии.
    7. Вторичная структура полипептидов. Спирали: 27, 310, α, poly(Pro) II. Антипараллельная и параллельная β-структура. β-изгибы. Методы экспериментального обнаружения вторичной структуры. Что такое «клубок»? Что такое «нативно-развернутые» белки?
    8. Теорема Ландау и не-фазовость перехода спираль-клубок. Размер кооперативного участка при переходе спираль-клубок.
    9. Стабильность α-спирали и β-структуры в воде. Скорость образования β-структуры (шпилек и листов) и α-спиралей.
    10. Свойства аминокислотных остатков (примеры: аланин, глицин, пролин, валин). Неполярные и полярные боковые группы. Заряженные боковые группы. Предпочтительные места для включения аминокислотных остатков во вторичную и в третичную структуру. Гидрофобные поверхности на вторичных структурах в белках.
    11. Фибриллярные белки, их функции и их периодичные первичные и вторичные структуры; α-кератин, β-фиброин шелка, коллаген. Упаковка длинных α-спиралей и обширных β-листов. Белки, образующие матрикс; эластин. Амилоиды.
    12. Мембранные белки, особенности их строения и функции. Бактериородопсин, порин, фотосинтетический центр. Селективная проницаемость мембранных пор. Работа фотосинтетического центра. Понятие о туннельном эффекте.
    13. Глобулярные белки. Упрощенное представление структур белковых глобул; структурные классы. Строение β-белков: β-слои, их продольная и перпендикулярная упаковка. Правопропеллерная скрученность β-листов. Примеры.
    14. Строение α-белков. Пучки и слои спиралей. Плотная упаковка при контакте α-спиралей. Строение α/β-белков: параллельный β-слой, прикрытый α-спиралями (укладка Россманна) и α/β-цилиндр. Топология β-α-β субъединиц. Строение α+β белков. Примеры.
    15. Классификация структур белков. “Стандартные” третичные структуры (примеры). Отсутствие прямой связи архитектуры белка с его функцией (примеры). Есть ли эволюция белковых структур? Дупликация гена и специализация. Эволюция путем перемешивания доменов.
    16. Основные закономерности, наблюдаемые в структурах белковых глобул: наличие отдельно α- и отдельно β-слоев; редкость перекрывания петель; редкость параллельности соседних по цепи структурных сегментов; редкость левых β-α-β суперспиралей. Физические причины этих феноменов.
    17. Связь частоты встречаемости разнообразных структурных элементов в нативных глобулярных белках с собственной свободной энергией этих элементов. Примеры.
    18. Кооперативные переходы. Обратимость денатурации белков. Денатурация глобулярного белка — переход типа “все-или-ничего”. Критерий Вант-Гоффа для перехода “все-или-ничего”.
    19. Тепловая и холодовая денатурация, денатурация растворителем. Диаграмма фазовых состояний белковой молекулы. Как выглядит денатурированный белок? Клубок и расплавленная глобула.
    20. Почему денатурация глобулярного белка — переход типа «все-или-ничего»? Распад плотной упаковки ядра белка и раскрепощение боковых групп.
    21. Самоорганизация белка in vivo и in vitro. Вспомогательные механизмы при самоорганизации in vivo: ко-трансляционное сворачивание, шапероны, и т.д. Спонтанная самоорганизация возможна in vitro. Понятие о “парадоксе Левинталя”.
    22. Опыты по сворачиванию белка “in vitro”. Обнаружение метастабильных (накапливающихся) интермедиатов сворачивания многих белков Расплавленная глобула — обычно (но не обязательно) наблюдаемый интермедиат сворачивания белка в нативных условиях.
    23. Одностадийное сворачивание малых белков. Теория перехòдных состояний. Ядро сворачивания нативной структуры белка. Его экспериментальное обнаружение in vitro методами белковой инженерии.
    24. Решение «парадокса Левинталя»: к стабильной структуре цепи автоматически ведет сеть быстрых путей сворачивания. Оценка времени сворачивания белка.
    25. Опознавание сходства пространственных структур белков по сходству их аминокислотных последовательностей. Попытки предсказания пространственных структур белков их аминокислотным последовательностям ab initio.
    26. Белковая инженерия (с примерами) и дизайн (с примерами). Подтверждение теории перехòдного состояния в катализе методами белковой инженерии. Абзимы.
    27. Элементарные функции белков. Связывающие белки: ДНК-связывающие белки, иммуноглобины. Ферменты и катализ. Каталитический и субстрат-связывающий центры.
    28. Ферменты и катализ (на примере сериновых протеаз). Почему твердость белка важна для элементарной ферментативной функции?
    29. Сопряжение элементарных функций белка и гибкость его структуры. Индуцированное соответствие. Подвижность доменов белка. Доменная структура: киназы, дегидрогеназы.
    30. Когда белку нужна (и когда не нужна) гибкость? Аллостерическая регулировка функции белка. Гемоглобин и миоглобин. Понятие о механизме мышечного сокращениия и о движении кинезина.

    Структура и функции белков

    Белки — очень важные молекулы, которые необходимы всем живым организмам. По сухому весу белки — самая крупная единица клеток. Белки участвуют практически во всех клеточных функциях, и каждой роли отводится отдельный тип белка, задачи которого варьируются от общей клеточной поддержки до передачи сигналов и передвижения клеток. Всего существует семь типов белков.

    Белки

    • Белки — это биомолекулы, состоящие из аминокислот, которые участвуют почти во всех клеточных действиях.
    • Происходит в цитоплазме, трансляция — это процесс, посредством которого синтезируются белков .
    • Типичный белок состоит из единственного набора из аминокислот . Каждый белок специально приспособлен для своей функции.
    • Любой белок в организме человека может быть создан из перестановок только 20 аминокислот.
    • Существует семь типов белков: антитела , сократительные белки, ферменты, гормональные белки, структурные белки, запасные белки и транспортные белки .

    Синтез белков

    Белки синтезируются в организме посредством процесса, называемого трансляцией . Трансляция происходит в цитоплазме и включает преобразование генетических кодов в белки. Генетические коды собираются во время транскрипции ДНК, где ДНК расшифровывается в РНК. Затем клеточные структуры, называемые рибосомами, помогают транскрибировать РНК в полипептидные цепи, которые необходимо модифицировать, чтобы они стали функционирующими белками.

    Аминокислоты и полипептидные цепи

    Аминокислоты являются строительными блоками всех белков, независимо от их функции.Белки обычно представляют собой цепочку из 20 аминокислот. Человеческое тело может использовать комбинации этих 20 аминокислот для производства любого необходимого ему белка. Большинство аминокислот следуют структурному шаблону, в котором альфа-углерод связан со следующими формами:

    • Атом водорода (H)
    • Карбоксильная группа (-COOH)
    • Аминогруппа (-Nh3)
    • А «переменная» группа

    Среди различных типов аминокислот «вариабельная» группа наиболее ответственна за вариации, поскольку все они имеют водородные, карбоксильные группы и связи аминогруппы.

    Аминокислоты соединяются посредством синтеза дегидратации, пока не образуют пептидные связи. Когда несколько аминокислот связаны между собой этими связями, образуется полипептидная цепь. Одна или несколько полипептидных цепей, скрученных в трехмерную форму, образуют белок.

    Структура белка

    Структура белка может быть глобулярной или волокнистой в зависимости от его конкретной роли (каждый белок является специализированным). Глобулярные белки обычно компактны, растворимы и имеют сферическую форму.Волокнистые белки обычно имеют удлиненную форму и нерастворимы. Глобулярные и волокнистые белки могут иметь один или несколько типов белковых структур.

    Существует четыре структурных уровня белка: первичный, вторичный, третичный и четвертичный. Эти уровни определяют форму и функцию белка и отличаются друг от друга степенью сложности полипептидной цепи. Первичный уровень является самым основным и рудиментарным, в то время как четвертичный уровень описывает сложные связи.

    Отдельная белковая молекула может содержать один или несколько из этих уровней структуры белка, и структура и сложность белка определяют его функцию. Коллаген, например, имеет суперскрученную спиральную форму, длинную, тягучую, прочную и похожую на веревку — коллаген отлично подходит для обеспечения поддержки. Гемоглобин, с другой стороны, представляет собой сложенный и компактный глобулярный белок. Его сферическая форма полезна для маневрирования по кровеносным сосудам.

    Типы белков

    Всего существует семь различных типов белков, к которым относятся все белки.К ним относятся антитела, сократительные белки, ферменты, гормональные белки, структурные белки, запасные белки и транспортные белки.

    Антитела

    Антитела — это специализированные белки, которые защищают организм от антигенов или чужеродных захватчиков. Их способность перемещаться по кровотоку позволяет им использоваться иммунной системой для идентификации и защиты от бактерий, вирусов и других чужеродных злоумышленников в крови. Один из способов, которым антитела противодействуют антигенам, — это их иммобилизация, чтобы они могли быть уничтожены лейкоцитами.

    Сократительные белки

    Сократительные белки отвечают за сокращение и движение мышц. Примеры этих белков включают актин и миозин. Эукариоты, как правило, обладают обильным количеством актина, который контролирует сокращение мышц, а также процессы клеточного движения и деления. Миозин приводит в действие задачи, выполняемые актином, снабжая его энергией.

    Ферменты

    Ферменты — это белки, которые облегчают и ускоряют биохимические реакции, поэтому их часто называют катализаторами.Известные ферменты включают лактазу и пепсин, белки, которые известны своей ролью в заболеваниях пищеварительной системы и в специальных диетах. Непереносимость лактозы вызвана дефицитом лактазы — фермента, расщепляющего сахарную лактозу, содержащуюся в молоке. Пепсин — это пищеварительный фермент, который в желудке расщепляет белки в пище. Нехватка этого фермента приводит к расстройству пищеварения.

    Другими примерами пищеварительных ферментов являются ферменты, присутствующие в слюне: амилаза слюны, калликреин слюны и лингвальная липаза — все они выполняют важные биологические функции.Амилаза слюны — это основной фермент, содержащийся в слюне, который расщепляет крахмал на сахар.

    Гормональные белки

    Гормональные белки — это белки-мессенджеры, которые помогают координировать определенные функции организма. Примеры включают инсулин, окситоцин и соматотропин.

    Инсулин регулирует метаболизм глюкозы, контролируя концентрацию сахара в крови в организме, окситоцин стимулирует схватки во время родов, а соматотропин — гормон роста, который стимулирует выработку белка в мышечных клетках.

    Структурные белки

    Структурные белки волокнистые и вязкие, что делает их идеальными для поддержки различных других белков, таких как кератин, коллаген и эластин.

    Кератины укрепляют защитные покрытия, такие как кожа, волосы, иглы, перья, рога и клювы. Коллаген и эластин поддерживают соединительные ткани, такие как сухожилия и связки.

    Белки хранения

    Запасные белки резервных аминокислоты для организма до момента использования.Примеры запасных белков включают яичный альбумин, который содержится в яичных белках, и казеин, белок на основе молока. Ферритин — еще один белок, который хранит железо в транспортном белке, гемоглобине.

    Транспортные белки

    Транспортные белки — это белки-переносчики, которые перемещают молекулы из одного места в другое в организме. Гемоглобин является одним из них и отвечает за транспортировку кислорода через кровь через красные кровяные тельца. Цитохромы, другой тип транспортных белков, действуют в цепи переноса электронов как белки-переносчики электронов.

    Какие примеры функции белков?

    Сводка таблицы:

    1) Ферменты. Каждый процесс, происходящий в организме, в какой-то момент или полностью включает химическую реакцию. Химические реакции протекают в соответствии с физическим законом, известным как свободная энергия Гиббса. Этот закон гласит, что для протекания химической реакции в систему должна быть вложена энергия. Количество энергии, необходимое для начала реакции, называется «энергией активации».Эта энергия активации не всегда доступна; этот тип реакции не является спонтанным. Вот почему существует ферментов . Ферменты катализируют реакцию, что означает, что они ускоряют ее и позволяют ей протекать быстрее, чем это могло бы произойти спонтанно.

    а. Фермент — это специализированный белок, который снижает энергию активации . Он не добавляет энергии системе, он уменьшает количество энергии, необходимое для начала реакции. Особое внимание следует уделить тому факту, что требования снижены, поскольку именно здесь студенты часто ошибаются.(Ферменты не добавляют энергии реакции ).

    Ферменты понижающие энергию активации:

    Ферменты снижают энергию активации, необходимую для реакции, связываясь со своим «субстратом» (молекулой, с помощью которой ферменты участвуют в реакции). Субстраты обычно подходят для определенных ферментов, что делает ферменты очень точными инструментами.

    Примечание: фермент может иметь более одного субстрата.

    В химических реакциях ничего не может произойти, пока молекулы не окажутся в непосредственной близости друг от друга.Следовательно, ферменты снижают энергию активации, связываясь с двумя соединениями, которые необходимы для химической реакции, — объединяя их. Это значительно увеличивает продуктивность клетки, так как избавляет от необходимости ждать, пока молекулы «столкнутся» друг с другом.

    Примечание: если бы все реакции, необходимые для жизни, протекали без ферментов, даже самые простые бактерии не смогли бы выжить! Ферменты абсолютно необходимы.

    Есть и другие способы, которыми фермент может способствовать реакции.Один из таких механизмов заключается в связывании с субстратом и последующем вскрытии субстрата, чтобы обнажить его функциональные группы. Это позволяет протекать реакции, которая обычно вообще не протекает (из-за закупоренного участка реакции).

    2) Структурные белки. Ферменты включают большую часть функциональных белков, но белки также могут быть использованы во многих других областях. Например, клетки и ткани не могут поддерживать свою структуру без структурных белков .Коллаген — хорошо известный структурный белок. Этот белок часто находится во внеклеточном матриксе (пространстве за пределами клетки), удерживающем вместе такие вещи, как сухожилия и связки.

    Другой структурный белок, обнаруженный в организме человека, называется актин. Это жизненно важная часть цитоскелета наших клеток и, следовательно, очень важна для их формы и конформации.

    3) Транспортные белки. Кислород, гормоны и многие другие вещества не могут перемещаться по телу без посторонней помощи.Для этого очень пригодятся транспортные белки. Думайте о них как о такси. Иногда человек оказывается в незнакомом месте и не может добраться до желаемого. Итак, он вызывает такси. Транспортные белки — это кабины. Кислород не может свободно плавать в крови человека по разным причинам, поэтому белок, называемый гемоглобином, связывается с ним и доставляет его к месту назначения.

    4) Моторные белки. Мышцы важны, потому что они работают вместе, чтобы производить сложные движения.Эти движения были бы невозможны без существования моторных белков . Белки, такие как миозин, способны изменять свою конформацию в ответ на химический стимул, позволяя клеткам, обладающим ими, изменять свою форму. Так они ускоряют свое положение в трехмерном пространстве.

    5) Белки хранения. Некоторые вещества, от которых зависит выживание нашего тела, опасны для окружающих тканей, если их беспрепятственно дрейфовать.Для этого имеется запасных белков . Например, железо хранится в печени с помощью белка, известного как ферритин.

    6) Сигнальные белки. Гормональная система организма функционирует как очень сложная почтовая система. Сигнальные белки , часто гормоны, представляют собой специализированные соединения, синтезированные для отправки сообщения в определенное или обширное место. Некоторые сигнальные белки посылают сообщение каждой клетке тела, а некоторые настолько специфичны, что их может распознать только один тип клеток.Эти белки несут такие команды, как фактор роста нервов ( NGF ), эпидермальный фактор роста ( EGF ) и многие другие.

    7) Рецепторные белки. Если есть сигнальные белки, должен быть кто-то, кто их получит. Хорошо известным примером является рецептор ацетилхолина , обнаруженный в мышечных клетках в нервно-мышечных соединениях. Они содержат определенные конформации, способные распознавать определенные сигнальные белки.

    8) Белки, регулирующие ген. Экспрессия гена очень сложна; он регулируется белками, редактируется, иногда повреждается, повторно редактируется и иногда заглушается. Для того, чтобы ген мог правильно транскрибироваться РНК-полимеразой, необходимо определенное направление. Если бы все гены экспрессировались одновременно, биологические организмы действительно были бы скоплением белков!

    Чтобы исправить это, клетка использует белки, называемые регуляторными белками . Они связываются с молекулой ДНК и делают одно из двух: активируют экспрессию генов или подавляют ее.Бактерии содержат репрессор лактозы, который предотвращает экспрессию фермента, необходимого для катаболизма лактозы, когда такой сахар недоступен. Точно так же есть белки, которые связываются с цепью ДНК, когда необходимо экспрессировать определенный ген — обычно это выполняется белком, участвующим в пути передачи сигнала.

    Регуляторный белок, ингибирующий или отключающий ген:

    9) Разное. Как было сказано выше, клетки обладают гораздо большим, чем восемь категорий белков.Однако, помимо восьми широких категорий, белки, которые не входят в границы, обычно создаются специально для клетки / организма, которые их содержат. У некоторых медуз, например, есть белок, называемый , зеленый флуоресцентный белок ( GFP ), который придает им мистические, зеленые, светящиеся в темноте свойства.

    Этот список ссылается на учебник под названием Essential Cell Biology, четвертое издание во всем его составе. Основная часть материала была найдена на странице 122.Среди авторов этой книги: Брюс Альбертс, Деннис Брей, Карен Хопкин, Александр Джонсон, Джулиан Льюис, Мартин Рафф, Кейт Робертс и Питер Уолтер. Для дальнейшего чтения этот учебник можно приобрести в Google Книгах [здесь]
    (https://play.google.com/store/books/details/Bruce_Alberts_Essential_Cell_Biology_Fourth_Editio?id=Cg4WAgAAQBAJ).

    Структура и функция белка

    Структура белка закладывает основу для его взаимодействия с другими молекулами организма и, следовательно, определяет его функцию.В этой статье будут рассмотрены структурные принципы белков и их влияние на функцию белка.

    Первичная структура белка

    Белки состоят из длинной цепи аминокислот. Даже при ограниченном количестве аминокислотных мономеров — в организме человека обычно встречается всего 20 аминокислот — их можно расположить множеством способов, чтобы изменить трехмерную структуру и функцию белка. Простое секвенирование белка известно как его первичная структура.

    Вторичная структура белка

    Вторичная структура белка зависит от локальных взаимодействий между частями белковой цепи, которые могут влиять на укладку и трехмерную форму белка. Есть две основные вещи, которые могут изменить вторичную структуру:

    • α-спираль: группы N-H в основной цепи образуют водородную связь с группой C = O четырех аминокислотных остатков ранее в спирали.
    • β-складчатый лист: группы N-H в основной цепи одной нити образуют водородные связи с группами C = O в основной цепи полностью вытянутой цепи рядом с ней.

    Также может быть несколько функциональных групп, таких как спирты, карбоксамины, карбоновые кислоты, тиоэфиры, тиолы и другие основные группы, связанные с каждым белком. Эти функциональные группы также влияют на складывание белков и, следовательно, на их функцию в организме.

    Третичная структура

    Третичная структура белков относится к общей трехмерной форме после вторичных взаимодействий. К ним относится влияние полярных, неполярных, кислотных и основных R-групп, которые существуют на белке.

    Четвертичный белок

    Четвертичная структура белка относится к ориентации и расположению субъединиц в белках с мульти-субъединицами. Это актуально только для белков с несколькими полипептидными цепями.

    Белки складываются в определенные формы в соответствии с последовательностью аминокислот в полимере, и функция белка напрямую связана с полученной трехмерной структурой.

    Белки могут также взаимодействовать друг с другом или с другими макромолекулами в организме, создавая сложные сборки.В этих сборках белки могут развивать функции, которые были невозможны в автономном белке, такие как выполнение репликации ДНК и передача клеточных сигналов.

    Природа белков также очень разнообразна. Например, некоторые из них довольно жесткие, а другие несколько гибкие. Эти характеристики также соответствуют функции белка. Например, более жесткие белки могут играть роль в структуре цитоскелета или соединительных тканей. С другой стороны, те, у кого есть некоторая гибкость, могут действовать как шарниры, пружины или рычаги, помогая в работе других белков.

    Функции белков

    Белки играют важную роль во многих важных биологических процессах и функциях. Они очень универсальны и выполняют множество различных функций в организме, как указано ниже:

    • Действовать как катализатор
    • Транспортные другие молекулы
    • Хранить другие молекулы
    • Обеспечить механическую поддержку
    • Обеспечивает иммунную защиту
    • Создать движение
    • Передавать нервные импульсы
    • Контроль роста и дифференцировки клеток

    Степень, в которой структура белков влияет на их функцию, демонстрируется влиянием изменений в структуре белка.Любое изменение белка на любом структурном уровне, включая небольшие изменения в укладке и форме белка, может сделать его нефункциональным.

    Список литературы

    1. https://www.ncbi.nlm.nih.gov/books/NBK21177/
    2. http://genome.tugraz.at/MolecularBiology/WS11_Chapter03.pdf
    3. https://www.boundless.com/biology/textbooks/boundless-biology-textbook/biological-macromolecules-3/proteins-56/protein-structure-304-11437/

    Структурная функция белка | Протокол

    4.16: Структурная функция белка

    Структурные белки — это категория белков, отвечающих за различные функции, от формы и движения клеток до поддержки основных структур, таких как кости, хрящи, волосы и мышцы. В эту группу входят такие белки, как коллаген, актин, миозин и кератин.

    Коллаген, самый распространенный белок у млекопитающих, встречается по всему телу. В соединительной ткани, такой как кожа, связки и сухожилия, он обеспечивает прочность на разрыв и эластичность.В костях и зубах он минерализуется с образованием твердых тканей и способствует их несущей способности. Помимо структурной поддержки, коллаген также может взаимодействовать с рецепторами клеточной поверхности и другими промежуточными молекулами для регулирования клеточных процессов, таких как рост и миграция, которые включают изменения формы клеток и тканей.

    Структурные белки составляют основу цитоскелета клетки. Цитоскелет состоит из трех типов нитей, микрофиламентов, промежуточных нитей и микротрубочек, каждый из которых состоит из различных структурных белков.Микрофиламент образуется, когда актин самополимеризуется в длинные повторяющиеся структуры. Эти актиновые филаменты вносят вклад в форму и организацию клеток; Кроме того, микрофиламенты также могут способствовать перемещению и делению клеток, когда они действуют вместе с миозином. Состав промежуточных волокон варьируется в зависимости от типа клетки. Существует около 70 различных генов, кодирующих различные промежуточные филаменты. Промежуточные филаменты в эпителиальных клетках содержат кератин, периферические нейроны содержат периферин, а саркомеры в мышечных клетках содержат десмин.Основная структурная функция этих нитей — укреплять клетки и организовывать их в ткани. Микротрубочки состоят из структурных белков, называемых тубулинами. Тубулины самоорганизуются с образованием микротрубочек, которые способствуют организации цитоплазмы, включая расположение органелл. Микротрубочки также необходимы для митоза и деления клеток.

    Поскольку структурные белки широко распространены, мутация в гене, кодирующем любой из этих белков, может иметь серьезные пагубные последствия.Например, мутация в гене, кодирующем коллаген, может привести к состоянию, известному как несовершенный остеогенез, которое характеризуется слабостью костей и деформациями соединительных тканей. Различные мутации в гене коллагена могут привести к синдрому Альпорта, который характеризуется проблемами в таких органах, как почки, глаза и уши.


    Рекомендуемая литература

    1. Лодиш, Х., Берк, А., Зипурски, С.Л., Мацудаира, П., Балтимор, Д., И Дарнелл, Дж. (2000). Молекулярная клеточная биология 4-е издание. Национальный центр биотехнологической информации, книжная полка .
    2. Ricard-Blum, S. (2011). Семейство коллагена. Биологические перспективы Колд-Спринг-Харбор , 3 (1), a004978.
    3. Домингес, Р., и Холмс, К. К. (2011). Структура и функции актина. Годовой обзор биофизики , 40 , 169-186.
    4. Даунинг, К. Х., & Ногалес, Э. (1998). Строение тубулина и микротрубочек. Текущее мнение в области клеточной биологии , 10 (1), 16-22.
    5. Гейслер Ф. и Лейбе Р. Э. (2016). Эпителиальные промежуточные нити: защитники от микробной инфекции ?. Ячейки , 5 (3), 29. doi: 10.3390 / Cell5030029

    Страница не найдена | Эксплораториум

    • Посещение
      • Календарь
      • После темных четвергов
      • Резервные билеты
      • Экспонаты
      • Музейные галереи
      • Работы на просмотре
      • Часы
      • Как добраться
      • Часто задаваемые вопросы о посетителях
      • Аренда мероприятий
    • Образование Программы развития
    • Бесплатные семинары для преподавателей
    • Инструменты для преподавания и обучения
    • Изучение обучения
    • Программы сообщества
    • Информационный бюллетень для преподавателей
  1. Изучение
    • Поиск по предметам
    • Мероприятия
    • Видео
    • Приложения
    • Приложения
    • Блоги
    • Сайты
  2. О нас
    • Наша история
    • Партнерские отношения
    • Глобальное сотрудничество
    • Изучите наши возможности
    • Искусство в Exploratorium
    • Свяжитесь с нами
  3. Присоединяйтесь + Поддержка 900 08
  4. Сделайте пожертвование сегодня!
  5. Членство
  6. Присоединяйтесь к нашему сообществу доноров
  7. Занимайтесь своим бизнесом
  8. Примите участие в мероприятии по сбору средств
  9. Узнайте о нашем охвате
  10. Спасибо нашим сторонникам
  11. Часто задаваемые вопросы для доноров и корпоративных членов
  12. Проведите ваше мероприятие
  13. Волонтер
  14. Магазин
    • Посетите
      • Часто задаваемые вопросы
      • Календарь
        • Сегодня
        • На этой неделе
        • Онлайн
        • Вечер после наступления темноты четверга
        • Искусство
        • Конференции
        • Киноискусство
        • Бесплатное + общественные мероприятия
        • Детские мероприятия
        • Kidsising Events + Семьи
        • Члены
        • Выделенные произведения искусства + Экспонаты
        • Особые часы
        • Закрытие частных мероприятий
      • Цены
      • Часы
      • Как добраться
      • Карта музея
      • Сниженные цены и советы сообщества
      • Доступность для
      • Доступность
      • Посещение с детьми
      • How to Exploratorium
      • Экспонаты
      • Тактильный купол
      • Работы на просмотре
      • Искусство кино
      • Kanbar Forum
      • Черный ящик
      • Музейные галереи
        • Галерея Бернарда и Барбро Ошер 1:
        • Человеческие феномены
        • Купол 9 0008
        • Пресс-релиз 1971 года
      • Черный ящик
      • Заявление куратора
    • Галерея 2: Занятие искусством
      • Заявление куратора
    • Галерея Bechtel 3: Видеть и размышлять
      • Заявление куратора
    • Галерея 4: Жить Systems
      • Заявление куратора
    • Галерея 5: Выставки на открытом воздухе
      • Заявление куратора
    • Обсерватория Фишер-Бэй Галерея 6: Наблюдение за ландшафтами
      • Полевая экологическая станция Wired Pier
      • Заявление куратора
  15. Ресторан и кафе
  16. Школьные полевые поездки
    • Как добраться
      • Автобусные маршруты для полевых поездок и других групп
    • Цены и скидки
    • Руководство по планированию
    • Резервирование
      • Форма запроса полевых командировок
    • Ресурсы
  17. Аренда мероприятий s
    • Комплекты оборудования и галереи
    • Галерея и терраса обсерватории Фишер-Бэй
    • Восточная галерея
    • Центральная галерея и открытая галерея Bechtel
    • Галерея Ошер Вест
    • Kanbar Forum

    • Свадьбы
    • Выпускные и школьные мероприятия
    • Дневные встречи и мероприятия
    • «Счастливый час на воде»

    • Часто задаваемые вопросы об аренде
  18. Мета-функциональные сигнатуры белков на основе информации о свойствах последовательности, структуры, эволюции и аминокислот

    Abstract

    Функция белка опосредуется различными аминокислотными остатками, как их положениями, так и типами, в последовательности белка.Некоторые аминокислоты отвечают за стабильность или общую форму белка, играя косвенную роль в функции белка. Другие играют функционально важную роль как часть активных или связывающих сайтов белка. Для данной белковой последовательности остатки и степень их функциональной важности можно рассматривать как сигнатуру, представляющую функцию белка. Мы разработали комбинацию подходов к прогнозированию функций, основанных на знаниях и биофизике, для выяснения отношений между структурными и функциональными ролями отдельных остатков и положений.Такую метафункциональную сигнатуру (MFS), которая представляет собой набор непрерывных значений, представляющих функциональную значимость каждого остатка в белке, можно использовать для более подробного изучения белков с известной функцией и для помощи в экспериментальной характеристике белков неизвестного происхождения. функция. Мы демонстрируем превосходную производительность MFS в прогнозировании функциональных сайтов белка, а также представляем четыре реальных примера применения MFS в широком диапазоне настроек для выяснения взаимосвязи между последовательностью белка, структурой и функцией.Наши результаты показывают, что подход MFS, который может объединять несколько источников информации, а также давать биологическую интерпретацию каждого компонента, значительно облегчает понимание и характеристику функции белка.

    Сведения об авторе

    Белки — это основные строительные блоки и функциональные молекулы клетки. Функция опосредуется конкретными аминокислотными остатками в последовательности белка в зависимости как от их положения, так и от типа. Белки традиционно описываются как последовательность аминокислот и, если они известны, экспериментально определенные координаты этой ковалентно связанной цепи.Здесь мы предлагаем расширить описание белка, включив в него количественную меру функциональной важности каждой составляющей аминокислоты. Результирующая сигнатура для белковой последовательности или структуры называется ее метафункциональной сигнатурой (MFS). Мы представляем ансамбль методов, основанных на знаниях и биофизике, которые используют различные типы доказательств для функциональной важности, в качестве автоматизированного общедоступного инструмента для построения такой MFS. Мы используем два набора контрольных данных, чтобы показать, что MFS можно использовать для идентификации функционально важных остатков только на основе структуры или последовательности белка.Наконец, мы оцениваем четыре разнообразных реальных биологических вопроса, чтобы продемонстрировать способность MFS дать представление о структурных и функциональных ролях отдельных остатков и положений, используя взаимосвязи между последовательностью белка, структурой и функцией.

    Образец цитирования: Ван К., Хорст Дж. А., Ченг Дж., Никль Д. К., Самудрала Р. (2008) Мета-функциональные сигнатуры белков на основе объединения информации о последовательности, структуре, эволюции и аминокислотных свойствах. PLoS Comput Biol 4 (9): e1000181.https://doi.org/10.1371/journal.pcbi.1000181

    Редактор: Расс Б. Альтман, Стэнфордский университет, Соединенные Штаты Америки

    Поступила: 15 апреля 2008 г .; Принята к печати: 7 августа 2008 г .; Опубликовано: 26 сентября 2008 г.

    Авторские права: © 2008 Wang et al. Это статья в открытом доступе, распространяемая в соответствии с условиями лицензии Creative Commons Attribution License, которая разрешает неограниченное использование, распространение и воспроизведение на любом носителе при условии указания автора и источника.

    Финансирование: Эта работа была поддержана стипендией Searle Scholar, наградой Национального научного фонда (NSF) CAREER, грантом NSF DBI-0217241, а также грантами Национальных институтов здравоохранения GM068152-01 и F30DE017522-02.

    Конкурирующие интересы: Авторы заявили, что никаких конкурирующих интересов не существует.

    Введение

    Огромные объемы последовательностей и структурных данных генерируются высокопроизводительными технологиями. Функциональные аннотации не охарактеризованных последовательностей и структур значительно отстают.Время и стоимость экспериментальных методов, необходимых для исследования функции всех не охарактеризованных белков, непомерно высоки. Поэтому вычислительные средства становятся все более полезными и популярными для прогнозирования и аннотирования функций для огромного количества данных последовательности и структуры [1], [2].

    Однако прогнозирование функции белков само по себе является сложной задачей для формулирования, поскольку трудно определить функцию [2], [3]. Различные схемы функционального определения (такие как Комиссия по ферментам [4], Онтология генов [5] и суперсемейство SCOP [6]) были разработаны на протяжении многих лет и касались различных аспектов функции белков.Вместо того, чтобы принять существующую схему функционального определения, мы предложили исследовать роль отдельных аминокислотных остатков в функции белка, независимо от используемых схем функционального определения. В таких случаях функция белка может быть представлена ​​просто как ряд количественных значений, каждое из которых указывает на функциональную важность соответствующего аминокислотного остатка в последовательности или структуре белка. Чтобы вычислить количественные значения для каждого остатка, мы использовали комбинированный подход, метафункциональную сигнатуру (MFS), которая учитывает индивидуальные оценки из различных алгоритмов прогнозирования функций и генерирует совокупную оценку для каждого аминокислотного остатка в данном белке. .В настоящее время наш протокол генерации подписи состоит из следующих четырех типов оценок для четырех различных типов информации: (1) сохранение последовательности, (2) эволюционное сохранение, (3) структурная стабильность и (4) тип аминокислоты. Все эти оценки генерируются с помощью концептуально простых и легко реализуемых алгоритмов (описанных ниже), а их совместное использование превосходит сложные алгоритмы, использующие только один источник информации.

    Консервация последовательности — один из наиболее часто используемых методов измерения функциональной важности отдельных аминокислот.Аминокислотные остатки с более консервативными моделями вариаций обычно более важны для сохранения функции белка. Эта концепция часто используется для идентификации функциональных областей белков путем построения нескольких выравниваний между последовательностью-мишенью и всеми ее гомологами последовательностей, а затем анализа степени сохранения последовательности среди каждого сайта выравнивания. На протяжении многих лет предлагались различные меры по сохранению последовательностей, различающиеся по сложности и изощренности [7].Простейшими мерами сохранения последовательности являются оценка энтропии и ее варианты [8] — [13]. Более сложные измерения [14] — [16] включают другую информацию, такую ​​как попарное сходство аминокислот, физико-химические свойства и теоретические профили последовательностей, в схемы оценки. Пакет программ AL2CO включает девять различных схем оценки, но эти оценки имеют тенденцию коррелировать друг с другом [17]. Недавно было также показано, что мера дивергенции Дженсена-Шеннона улучшает предсказание функционально важных остатков и что учет сохранения в последовательно соседних сайтах еще больше повышает точность [18].Ранее мы продемонстрировали, что мера относительной энтропии, которая включает фоновые частоты аминокислот, может лучше предсказать функциональные сайты, чем простые меры энтропии [19]. Кроме того, мы обнаружили, что включение частот аминокислот, оцененных с помощью скрытых марковских моделей (HMM), дополнительно улучшает характеристики меры относительной энтропии [19]. В текущем исследовании мы используем меру сохранения последовательности, полученную из HMM (HMM_rel_ent), как один из компонентов нашего протокола генерации метафункциональной подписи.

    В дополнение к сохранению последовательности, мы также включаем информацию о сохранении эволюции в метафункциональную сигнатуру. Многие исследования показали, что использование филогенетических отношений между группой эволюционно связанных последовательностей помогает точно предсказать функциональные сайты. Метод Evolutionary Trace, один из первых и наиболее успешных из таких методов, анализирует паттерны вариации остатков внутри и между подсемействами белков в результате множественных выравниваний, сопоставляет важные остатки со структурой белка и количественно оценивает важность остатков [20], [21].Дальнейшее развитие метода эволюционного следа позволяет количественно ранжировать важность остатков, комбинируя использование эволюционной информации и энтропийных мер [22], [23]. Точно так же метод ConSurf конструирует филогенетические отношения из группы похожих последовательностей, вычисляет оценку сохранения с помощью байесовского метода или метода максимального правдоподобия и отображает информацию о сохранении на поверхность белка [24], [25]. Кроме того, исследование Soyer et al. использовали сайт-специфические эволюционные модели, которые предполагали различную матрицу замен для каждого сайта, для обнаружения функциональных сайтов белка [26].La et al. использовали эволюционные отношения между фрагментами последовательностей (филогенетические мотивы) для определения функциональных сайтов белков [27]. дель Соль Меса и др. представили несколько автоматизированных методов, которые делят данное семейство белков на подсемейства и ищут остатки, определяющие специфичность [28]. Общность всех этих методов заключается в том, что взаимосвязи последовательностей анализируются на основе топологии эволюционного дерева, что обеспечивает дополнительный уровень информации вместо того, чтобы полагаться только на несколько выравниваний последовательностей.Здесь мы предлагаем новый метод, называемый оценкой отношения состояния к шагу (SSR), для измерения эволюционного сохранения. На основе заданных множественных выравниваний мы строим дерево максимальной экономии и анализируем модели вариаций от корня дерева (теоретическая наследственная последовательность) до листа дерева (последовательности в нескольких выравниваниях), чтобы создать оценку для каждого аминокислотного остатка. . Оценка SSR — простой, но эффективный способ измерения эволюционной сохранности.

    Оценки функциональной сигнатуры также могут быть получены с помощью методов, основанных на биофизике, с использованием экспериментально определенных или предсказанных с помощью вычислений структур белков.Например, недавнее исследование продемонстрировало, что дестабилизирующие области в белковых структурах часто могут быть использованы для получения ценной информации для функциональных выводов и идентификации функциональных сайтов [29]. Для данной структуры и данного положения мы предлагаем мутировать остаток дикого типа на 19 других аминокислот и рассчитать их оценки структурной стабильности, которые, в свою очередь, можно использовать для присвоения оценки каждому остатку в белке. Следовательно, эти оценки также могут служить компонентом прогнозирования функции белков.Ранее мы разработали специфичную для остатков функцию различения вероятностей для всех атомов (RAPDF) [30], которая собирает статистику из базы данных экспериментальных структур для оценки и выбора «ложных» структур, которые с большей вероятностью будут похожи на экспериментально полученные структуры. RAPDF был оптимизирован и усовершенствован в последние годы для предсказания структуры белков [31] — [33]. Здесь мы дополнительно расширили RAPDF для оценки мутаций остатков на основе остатков. Каждый остаток в данном белке был мутирован в одну из 19 альтернативных аминокислот, создавая новые структуры, которые были дополнительно оптимизированы по топологии (через перестройку боковой цепи) и максимизированы для стабильности (через глобальное возмущение конформации).В нашем текущем протоколе генерации MFS мы использовали две функции оценки на основе RAPDF (RAPDF_spread и RAPDF_dif), чтобы измерить, как все мутировавшие структуры отклоняются друг от друга и как экспериментально определенная структура отличается от мутированных структур, что представляет потенциальное влияние на стабильность для положение и для встречающегося в природе остатка, соответственно. Эти оценки отделяют остатки, сохраняемые для структуры и функции.

    Дополнительным компонентом метафункциональной сигнатуры является информация о типе аминокислот, таких как гистидин и цистеин, которые с большей вероятностью располагаются в функциональных сайтах, чем другие аминокислоты.Однако такая «априорная вероятность» для функционального сайта явно не моделируется и не включается в большинство современных алгоритмов прогнозирования функционального сайта. В нашем протоколе создания MFS мы использовали 19 бинарных переменных (все, кроме аланина), чтобы представить идентичность аминокислот для каждой позиции в данном белке. Мы также исследовали, может ли явное использование информации об аминокислотах (например, AAType), в отличие от неявного использования (например, посредством вычисления относительной энтропии), предоставить дополнительную информацию и повысить производительность.

    Учитывая сложность определения и идентификации функциональных сайтов белков, очевидно, что ни один метод не всегда будет работать для сбора всей информации о функциональных сайтах белка. Поэтому несколько групп начали использовать информацию из различных источников, особенно информацию, полученную из структур, чтобы давать более точные прогнозы. Работа Chelliah et al. показал, что различение структурных и функциональных ограничений для аминокислотных остатков приводит к лучшему предсказанию сайтов взаимодействия с белками [34].Мы показали, что, рассматривая как структурные, так и функциональные ограничения эволюции белков, мы можем лучше идентифицировать функциональные сайты и сигнатуры [35], [36]. Недавно Петрова и соавт. показали, что интеграция семи выбранных последовательностей и структурных особенностей в каркас машины опорных векторов (SVM) может улучшить идентификацию каталитических сайтов [37]. Кроме того, Fischer et al. интегрированная консервация последовательности, распределение аминокислот, предсказанная вторичная структура и относительная доступность растворителя в структуре плотности вероятности и показали, что при 20% чувствительности интегрированный метод приводит к 10% увеличению точности по сравнению с неинтегрированными методами предсказания каталитических остатков из Атлас каталитического участка и записи САЙТА PDB [38].Youn et al. исследовали различные особенности для различения каталитических остатков от некаталитических в новых структурных складках и показали, что мера сохранения последовательности, мера структурной консервации, степень уникальности структурной среды остатка, доступность растворителя и гидрофобность остатка являются лучшими предикторами каталитических центров [39]. Другие аналогичные исследования также включали от десятков до сотен функций в структуру машинного обучения для идентификации каталитических сайтов [40], [41].В целом, предыдущая работа предполагает большую ценность использования нескольких комплементарных последовательностей и структурных компонентов для оценки каталитических центров. В отличие от этих подходов, которые в значительной степени основывались на алгоритмах машинного обучения, в текущем исследовании мы стремимся объединить несколько источников информации о последовательности, структуре, эволюции и типе аминокислот вместе с помощью простой модели логистической регрессии для прогнозирования функций, включая как каталитические сайты, так и сайты связывания. Основным преимуществом регрессионной модели является то, что каждый компонент может быть связан с биологически значимой интерпретацией, и что отдельные баллы для белка можно изучать вручную, чтобы получить дополнительную информацию о различных аспектах функции белка, которые недоступны, когда много компонентов брошены в сложную структуру машинного обучения.Мы сравниваем подход MFS с несколькими другими алгоритмами прогнозирования функционального сайта, предлагаем улучшения нашего подхода, приводим примеры широкого определения функции, оцениваемой MFS, и обсуждаем, как различные компоненты MFS могут использоваться для понимания биологической функции на четырех реальных примерах.

    Методы

    Компоненты метафункциональных сигнатур

    Оценка сохранения последовательности.

    Мы провели поиск каждой последовательности запросов в базе данных Uniref90 [42], используя три итерации программы PSI-BLAST [43], и построили несколько сопоставлений.Затем мы составили модель HMM, используя пакет HMMER [44], и рассчитали относительную энтропию положения, используя частоты аминокислот, оцененные с помощью модели HMM.

    Оценка HMM_rel_ent была рассчитана следующим образом: p i ( i = 1,…, 20) представляет частоту эмиссии аминокислот, оцененную с помощью модели HMM, а p ib представляет заданную частоту аминокислотного фона. в karlin.c программного пакета BLAST [43].

    Эволюционная оценка сохранения.

    Используя множественные выравнивания, сгенерированные на предыдущем шаге, мы построили филогенетические деревья с методами максимальной экономии, используя программу protpars в программном пакете PHYLIP [45]. Когда существовало несколько столь же экономных деревьев, мы использовали первое дерево. Затем для каждой выровненной позиции мы вычисляем отношение состояния к шагу (SSR), где N state — это количество типов остатков в данной позиции выравнивания, а N step — общее количество изменений типа остатка в положение, выведенное из корня дерева.

    Оценка структурной устойчивости.

    В качестве индикатора структурной стабильности мы использовали показатель вероятностно-дискриминирующей функции для всех атомов (RAPDF). Оценка RAPDF основана на условной вероятности того, что конформация является нативной, с учетом набора межатомных расстояний. Подробная формулировка шкалы RAPDF описана в [30], [31]. Первоначальная версия этой функции использовалась в качестве ключевого компонента наших методов предсказания структуры белка, которые хорошо работают в экспериментах по слепому предсказанию CASP [33], [46].В текущем исследовании мы использовали модифицированную версию оценки RAPDF [32], RAPDF с 37 ячейками, с использованием интервалов расстояний с интервалом 0,5 Å (вместо интервала 1 Å в исходной формуле).

    Для каждого аминокислотного остатка в данной структуре белка мы сначала мутировали аминокислоту до одной из 19 альтернативных аминокислот и использовали программу генерации боковой цепи SCWRL [47], чтобы перестроить боковую цепь мутированной аминокислоты. Мы применили протокол минимизации энергии ENCAD [48] в качестве промежуточного шага (необязательного в программном обеспечении MFS), чтобы минимизировать стерические помехи.Затем мы рассчитали значения RAPDF с помощью модифицированной версии потенциальной программы в программном пакете RAMP, которая использует 37 интервалов расстояний для статистического вывода [32]. Затем из набора из 20 значений RAPDF для аминокислоты дикого типа и 19 альтернативных аминокислот мы составили две разные итоговые оценки.

    Первая суммарная оценка — это оценка RAPDF_spread, которая представляет собой стандартное отклонение оценок RAPDF для 20 мутированных структур, которые отличаются одним остатком, и рассчитывается как

    Вторая суммарная оценка — это оценка RAPDF_dif, которая рассчитывается как где S RAPDF, wt — значение RAPDF для структуры дикого типа.Оценка RAPDF_dif вычисляет разницу между структурой дикого типа и средним значением всех 20 возможных структур, в то время как оценка RAPDF_spread оценивает все 20 оценок как распределение и не связано с идентичностью аминокислоты дикого типа. Обе оценки измеряют различные аспекты структурной стабильности, вызванной мутациями аминокислот: оценка RAPDF_dif оценивает влияние аминокислоты дикого типа на стабильность, тогда как оценка RAPDF_spread оценивает потенциальное влияние этой позиции.

    Оценка типа аминокислот.

    Поскольку разные аминокислоты могут иметь разное распределение в функционально важных и неважных сайтах (априорная вероятность того, что аминокислота является функционально важной), мы также ввели в нашу модель набор фиктивных переменных, представляющих аминокислотную идентичность остатка, являющегося считается. 19 оценок, S атип, 2 ,…, S атип, 20 , все являются бинарными переменными (принимающими значение 1 или 0) и указывают, присутствует ли соответствующая аминокислота (AAType).

    Обработка несоответствия между структурой последовательности и положением.

    Мы использовали наборы данных функциональных сайтов на основе структуры для оценки производительности наших методов. Многие файлы PDB содержат разрывы цепочки, поэтому использование записей ATOM в схемах оценки на основе последовательностей неразумно, поскольку сгенерированные множественные выравнивания могут быть неточными, особенно при наличии больших разрывов цепочки. В нашем методе MFS две оценки подписи на основе последовательности (HMM_rel_ent, SSR) генерируются с использованием записей SEQRES файлов PDB; следовательно, необходим перевод этих основанных на SEQRES координат в основанные на ATOM координаты.Для этого мы выполнили глобальное попарное выравнивание последовательности на основе ATOM и последовательности на основе SEQRES с использованием алгоритма Нидлмана-Вунша, реализованного в программном пакете EMBOSS [49]. Затем мы проанализировали каждую выровненную позицию, чтобы решить проблему несоответствия SEQRES-ATOM: пробелы в выравнивании указывают на разрывы цепи в записях ATOM, в то время как несогласованные остатки в выравнивании представляют собой мутировавшие остатки при кристаллизации структуры. Мы отмечаем, что хотя глобальное выравнивание последовательностей обычно работает хорошо, могут быть случаи, когда очень большие разрывы цепи препятствуют точному выравниванию; в этих случаях внешние инструменты, такие как сервер S2C (http: // dunbrack.fccc.edu/Guoli/s2c/index.php) может использоваться вместе с файлами PDB для связи последовательности с координатами с данными, полученными из файлов в формате XML. Оценки сигнатуры, сгенерированные из последовательности на основе SEQRES, затем могут быть присвоены соответствующим аминокислотным остаткам на основе ATOM в файле PDB.

    Построение регрессионных моделей.

    После того, как мы сгенерировали оценки HMM_rel_ent, SSR, RAPDF_spread, RAPDF_dif и AAType, мы сопоставили данные с известными функциональными сайтами, используя следующую модель логистической регрессии: где p — вероятность того, что позиция является функционально важной позицией, a от до f — это параметры модели, а ε — ошибка.Подбор модели, проверка модели, оценка производительности и эксперименты по перекрестной проверке проводились в программной среде программирования STATA версии 9.2 (Колледж-Стейшн, Техас).

    Оценка эффективности идентификации функционального участка

    Мы использовали набор данных Thornton [50] и набор данных Lovell [34], чтобы оценить эффективность MFS и его вариантов при идентификации функциональных сайтов из белковых структур. Набор данных Thornton содержит 1546 активных сайтов ферментов из 508 белков, а набор данных Lovell содержит 1137 функциональных сайтов из 243 белков.Мы оценили эффективность функциональной идентификации сайта по двум критериям, которые использовались в предыдущих исследованиях [19]. Первым критерием является оценка ROC, которая оценивает, как количественные прогнозы функциональной важности соотносятся с бинарными определениями того, является ли сайт функциональным. Эта оценка рассчитывается как площадь под кривой путем построения графика соотношения ложноположительных результатов и истинно положительных результатов в диапазоне пороговых значений. Второй критерий — это 10 самых успешных оценок, которые подсчитывают, сколько из 10 лучших оценочных остатков в данном белке также являются остатками активного сайта.Для данного набора данных сумма 10 лучших результатов для всех белков используется для оценки производительности различных алгоритмов. Кроме того, мы также рассчитали специфичность и количество ложноположительных результатов для каждого белка при достижении 20% чувствительности. Предполагая, что TP, TN, FP и FN представляют собой истинно положительные, истинно отрицательные, ложноположительные и ложно отрицательные прогнозы, соответственно, чувствительность относится к TP / (TP + FN), точность относится к TP / (FP + TP) и частота ложных срабатываний относится к FP / (FP + TN).Для методов MFS и SeqonlyMFS мы применили эксперименты с пятикратной перекрестной проверкой, чтобы оценить их эффективность: весь набор данных был разделен на пять частей, и во время каждой перекрестной проверки 80% белков использовались для обучения модели, что было затем протестировали оставшиеся 20% белков.

    Мы оценили эффективность метода MFS в сравнении с двумя широко используемыми программами идентификации функциональных сайтов для белковых структур: сервером Evolutionary Trace (http: // mammoth.bcm.tmc.edu/report_maker) и сервер ConSurf (http://consurf.tau.ac.il). Мы использовали идентификатор PDB для запроса наборов данных Thornton и Lovell, используя оба сервера со всеми параметрами по умолчанию, и собрали выходные файлы ZIP с сервера ET и выходные файлы «оценки сохранения аминокислот» с сервера ConSurf. Некоторые белки генерируют сообщения об ошибках или не могут обрабатываться ни одним из серверов, поэтому они не были включены в наш анализ. Затем мы использовали значение «rho ET score» из файла оценки ET и значение сохранения из файла оценки ConSurf, чтобы оценить производительность этих методов с помощью ROC и 10 лучших результатов.Сервер ET генерирует много равных оценок (обычно намного больше 10) для остатков с наивысшей оценкой; Таким образом, рейтинг 10 лучших совпадений не использовался для ET в нашем сравнительном анализе.

    Для каждого метода мы также создали файлы модифицированной структуры PDB, в которых поле температуры было заменено прогнозируемыми оценками функциональной важности. Затем эти структуры были визуализированы с использованием программного обеспечения UCSF chimera [51], так что цвет каждого остатка представляет собой значение оценки функциональной важности.Визуальный осмотр сгенерированных структур помогает понять, как и почему каждый метод работал или не удался.

    Реализация веб-сервера для генерации MFS

    Мы реализовали протокол генерации MFS как веб-сервер, доступный по адресу http://protinfo.compbio.washington.edu/mfs. Входные данные для этого сервера представляют собой последовательность из одной цепочки или структуру в формате FASTA или PDB соответственно, а выходными данными является прогнозируемая оценка MFS для каждого остатка в структуре.Кроме того, когда предоставляется входная структура, создается новый файл структуры с полем температурного фактора, замененным оценками MFS, чтобы обеспечить визуальный контроль функционально важных областей с помощью программного обеспечения для молекулярной графики. Если файл структуры содержит много разрывов цепи в записях ATOM, пользователь может дополнительно отправить полную последовательность, чтобы можно было сгенерировать более точное выравнивание последовательностей для белка запроса. Если пользователи отправляют только информацию об аминокислотных последовательностях, то для прогнозирования функциональных сайтов будет использоваться протокол генерации SeqonlyMFS.Для белка среднего размера с 200 остатками вычисление для SeqonlyMFS может быть выполнено в течение одного часа, в то время как вычисление для MFS на основе структуры может быть выполнено в течение одного дня, когда очередь на обработку не занята. Этот сервер будет постоянно обновляться, когда наш протокол генерации MFS будет дорабатываться и улучшаться. Автономный исходный код, используемый для создания MFS, также можно загрузить по тому же URL-адресу.

    Результаты

    Вклад компонентов метафункциональной сигнатуры в идентификацию функционального сайта

    Оценка производительности наших протоколов метафункциональной сигнатуры (MFS) потребовала от нас использования «золотого стандарта» набора данных о функциональных сайтах белков с известной структурой.Мы не использовали записи «SITE» в файлах PDB или записи «ACT_SITE» в файлах Swiss-Prot, потому что эти аннотации, как правило, нечетко определены и содержат высокий уровень ошибок и низкий уровень охвата [50]. Вместо этого мы использовали набор данных Thornton [50] и набор данных Lovell [34], которые использовались в предыдущих экспериментах [19], [36]. Набор данных Thornton содержит аннотированные вручную активные центры ферментов, извлеченные из первичной литературы; Набор данных Lovell содержит вручную скомпилированные сайты связывания лигандов на основе литературы.Для оценки производительности мы использовали показатель ROC и рейтинг топ-10, как описано ранее [19]. Чтобы исследовать добавленную стоимость каждого компонента метафункциональных сигнатур, мы сравнили характеристики дополнительных компонентов MFS: сохранение последовательности (HMM_rel_ent), эволюционное сохранение (SSR), тип аминокислоты (AAType), стабильность структуры положения (RAPDF_spread ) и остаточной структурной стабильности (RAPDF_dif) (Рисунок 1). Последовательное включение каждого компонента улучшает производительность.MFS, использующая максимальное количество компонентов, имеет лучшую производительность при прогнозировании функциональных сайтов.

    Рис. 1. Точность функциональной идентификации сайта в наборах данных Thornton и Lovell несколькими методами, которые используют только информацию о последовательности (HMM_rel_ent), затем с добавлением эволюционной информации (HMM_rel_ent + SSR) с последующим добавлением информации о типе аминокислоты (HMM_rel_ent + SSR + AAType) и, наконец, с дополнительной структурной информацией (MFS).

    Для оценки производительности использовались баллы ROC и 10 лучших результатов. Четыре метода имеют возрастающую точность, демонстрируя важность объединения информации о последовательности, структуре, эволюции и типе аминокислот при функциональной характеристике белков.

    https://doi.org/10.1371/journal.pcbi.1000181.g001

    Высокая корреляция между компонентами (независимыми переменными) в линейной модели будет иметь тенденцию дестабилизировать параметры модели и давать ошибочную статистическую значимость.Чтобы выяснить, есть ли у наших моделей MFS такие проблемы, мы проверили коэффициент инфляции дисперсии (VIF). VIF — это мера для каждой независимой переменной, позволяющая оценить, как коллинеарность переменных влияет на точность оценки параметров. Оценка VIF выше 10 обычно указывает на проблемные модели. Мы обнаружили, что все оценки VIF для параметров в моделях MFS при применении к обоим наборам данных меньше 4, что указывает на то, что наши модели не страдают от проблем коллинеарности. Кроме того, мы рассчитали парные коэффициенты корреляции между оценкой HMM_rel_ent, оценкой SSR, оценкой RAPDF_spread и оценкой RAPDF_dif для обоих наборов данных (таблица 1).Мы обнаружили, что максимальное абсолютное значение коэффициента корреляции составляет 0,45 между оценками HMM_rel_ent и SSR. Следовательно, каждый компонент протокола MFS предоставляет дополнительную и преимущественно ортогональную информацию, и их можно использовать индивидуально для оценки различных аспектов функции.

    Таблица 1. Коэффициенты корреляции нескольких компонентов метода MFS в наборе данных Thornton (ячейки в верхнем правом треугольнике таблицы) и в наборе данных Ловелла (нижний левый треугольник), соответственно.

    https://doi.org/10.1371/journal.pcbi.1000181.t001

    Сравнительный анализ характеристик метафункциональной сигнатуры

    Было создано несколько веб-серверов, которые присваивают количественные оценки функционально важным аминокислотным остаткам и сопоставляют эти оценки со структурами белков для идентификации пространственных кластеров важных остатков. Мы сравнили производительность MFS с двумя такими веб-серверами, сервером Evolutionary Trace (ET) и сервером ConSurf.Сервер ET реализует метод, который объединяет эволюционную и энтропийную информацию для ранжирования каждого остатка по его функциональной важности [23], в то время как метод ConSurf использует филогенетическую информацию для измерения сохранения остатка [24]. Хотя и методы ET, и методы ConSurf сопоставляют оценки со структурами белков, эти методы не используют явным образом структурную информацию при расчете функциональной важности. Поэтому для сравнения мы также использовали метод SeqonlyMFS, который не использует структурную информацию.

    Для сравнения этих методов мы использовали те же наборы данных и показатели производительности, что и в предыдущем разделе. Однако, поскольку сервер ET и сервер ConSurf выдавали сообщения об ошибках или не могли обрабатывать некоторые белки, мы сосредоточили наш анализ на белках 453/508 в наборе данных Thornton и на белках 226/243 в наборе данных Lovell, для которых оба сервера генерировали выходные данные (рис. 2). Кроме того, мы не подсчитывали топ-10 оценок для сервера ET, потому что для любого данного белка этот сервер обычно генерирует намного больше, чем 10 равных оценок, связанных на первом месте.Мы обнаружили, что MFS и SeqonlyMFS превосходят оба сервера при сравнении их показателей ROC: для сравнения SeqonlyMFS и ET P-значения знакового теста составили 1,2e-25 и 4,4e-15 для наборов данных Thornton и Lovell соответственно; для сравнения SeqonlyMFS и ConSurf значения P составили 1,4e-39 и 1,3e-16 соответственно. Кроме того, SeqonlyMFS и MFS сгенерировали значительно больше попаданий в топ-10, чем сервер ConSurf для обоих наборов данных. Отметим, что в реальных приложениях более важно оценивать производительность, когда даются только самые надежные прогнозы; поэтому мы также сравнили показатель точности и частоту ложных срабатываний при достижении 20% чувствительности для каждого белка.По обоим параметрам MFS по-прежнему имеет лучшую производительность среди всех методов (рисунок 2). Наконец, поскольку каждый белок может иметь различное количество функциональных сайтов, сумма первых 10 совпадений для всех белков может не быть оптимальной мерой ожидаемой производительности для данного белка. Поэтому мы рассчитали чувствительность каждого метода для каждого белка. Для набора данных Thornton средние значения чувствительности для всех белков составляют 67,0%, 62,5% и 33,7% для MFS, SeqonlyMFS и ConSurf соответственно.Для набора данных Lovell средние значения чувствительности составляют 70,0%, 66,9% и 40,8% соответственно. В целом, по сравнению с методами, использующими только один источник информации, подход MFS, объединяющий несколько источников информации, может дать улучшенную производительность при прогнозировании функционально важных остатков.

    Рисунок 2. Сравнение производительности метода MFS, метода SeqonlyMFS (HMM_rel_ent + SSR + AAType), метода эволюционной трассировки и метода ConSurf с наборами данных Thornton и Lovell.

    В сравнении используются только те белки, для которых методы Evolutionary Trace и ConSurf могут давать прогнозы. Для сравнения производительности используются четыре показателя, в том числе: оценки ROC, точность, когда порог чувствительности установлен на 20%, частота ложных срабатываний, когда порог чувствительности установлен на 20%, и 10 лучших результатов. ET используется только при вычислении оценки ROC, но не в другом сравнительном анализе, поскольку он дает много равных оценок для остатков с наивысшей оценкой. И методы MFS, и SeqonlyMFS имеют лучшую производительность, чем методы, использующие только один тип информации.

    https://doi.org/10.1371/journal.pcbi.1000181.g002

    Приложения метафункциональных сигнатур

    Метод MFS можно рассматривать как инструмент для определения функции белка как серии количественных значений. В качестве альтернативы, при рассмотрении каждого компонента MFS также можно рассматривать как несколько векторов с одинаковыми размерами. В предыдущих разделах мы продемонстрировали применение MFS для функциональной идентификации сайтов. Здесь мы также демонстрируем использование MFS в других типах задач вычислительной биологии на четырех примерах.

    Идентификация биологических механистических остатков путем сопоставления оценок MFS с белковыми структурами.

    Было доказано, что сопоставление определенной группы остатков в последовательности белка со структурой белка является мощным способом изучения функции белка, поскольку визуальный осмотр человека часто может выявить закономерности кластеризации остатков и помочь в интерпретации взаимосвязей структура-функция . Мы применили этот подход, чтобы изучить, как и почему работает метод MFS, сравнив образцы высокоуровневого картирования остатков, сгенерированные различными методами.

    Орнитиндекарбоксилаза .

    Мы использовали прогнозируемые баллы функциональной важности для орнитиндекарбоксилазы (идентификатор PDB 1ord-A) в качестве примера, чтобы проиллюстрировать различную производительность четырех методов: MFS, SeqonlyMFS, ET и ConSurf. Структуры представлены в виде лент, с тремя функциональными каталитическими сайтами (223H-316D-355K), отмеченными сферами, а все остатки окрашены в соответствии с их прогнозируемой оценкой функциональной важности (рис. 3A). Для этого белка 3, 2 и 0 функциональных сайтов правильно идентифицированы в топ-10 совпадений методами MFS, SeqonlyMFS и ConSurf, соответственно (ET определяет 3 сайта в своих топ-58 совпадениях из-за многих связанных оценок).Поэтому подробный анализ этих структур поможет нам понять, чем и почему методы различаются по своей производительности.

    Рис. 3. Различные прогностические характеристики метода MFS, метода SeqonlyMFS, сервера эволюционной трассировки и сервера ConSurf на двух примерах.

    Структура орнитиндекарбоксилазы (A) (идентификатор PDB 1ord-A) и целлобиогидролазы (B) (идентификатор PDB 1cel-A) показана на ленточных изображениях с функциональными сайтами (223H-316D-355K в 1ord-A). A, 212E-214D-217E-228H в 1cel-A) в виде сфер.Каждый остаток окрашен в соответствии с прогнозируемой оценкой функциональной важности, причем цвет меняется с красного на белый и на синий по мере уменьшения оценки. Для 1ord-A (A) и MFS, и SeqonlyMFS хорошо работают при присвоении наивысших оценок функциональным сайтам. Однако ET и ConSurf также присваивают высокие баллы близлежащим остаткам в окружающей полости, поэтому функциональные сайты не появляются в списках первой десятки совпадений, которые создаются этими методами. Для 1cel-A (B) все методы на основе последовательностей могут назначать относительно высокие баллы функциональным сайтам (разные оттенки красного цвета), но только метод MFS, который использует структурную информацию, может повысить оценки функциональных сайтов. выше (более интенсивный красный цвет), чтобы появиться в списке 10 лучших результатов.

    https://doi.org/10.1371/journal.pcbi.1000181.g003

    Ортининдекарбоксилаза имеет три структурных домена: N-концевой «крыловидный» домен (внизу слева на рисунке), RLP-зависимая трансфераза домен, который содержит большую полость с каталитической триадой внутри и небольшой C-концевой α + β домен, который частично закрывает полость (верхний структурный домен на рисунке). Оба метода ET и ConSurf присваивают высокие баллы (показаны красным и светло-красным цветом) многим остаткам вокруг полости белка.Однако три активных центра не получают наивысших оценок этими двумя методами, поэтому методы ET и ConSurf не могут отличить эти остатки от других остатков в той же полости. В таких случаях, хотя кластер высоко оцениваемых остатков можно различить визуально, химически функциональные сайты по-прежнему не могут быть легко выведены этими двумя методами. Однако, поскольку как методы MFS, так и методы SeqonlyMFS используют информацию, основанную на типе аминокислот, они могут генерировать более высокие баллы для функциональных сайтов, наблюдаемых в наборах тестов (в нашей модели гистидин, аспарагиновая кислота и лизин имеют более высокие оценки. вкладов, чем другие типы остатков), что приводит к лучшей идентификации биологически механистических функциональных сайтов.

    Целлобиогидролаза .

    Вторым примером является целлобиогидролаза (идентификатор PDB: 1cel-A), которая имеет сэндвич-образную складку, содержащую несколько нитей на двух листах (рис. 3B). Четыре функциональных сайта (212E-214D-217E-228H) последовательно и пространственно близки друг к другу. Только метод MFS может правильно идентифицировать 3 из 4 функциональных сайтов для этого белка в списке топ-10, в то время как методы SeqonlyMFS и ConSurf не могут идентифицировать ни одного (ET идентифицирует 3 сайта в своих 52 лучших сайтах из-за многих связанных баллов).Чтобы упростить визуальный осмотр, мы раскрасили структуру так, чтобы только остатки с относительно высокой оценкой имели разные оттенки красного, а все остальные остатки были синими. (Например, для метода SeqonlyMFS четыре функциональных сайта показаны белым, голубым, светло-красным и красным цветом соответственно, что указывает на то, что они имеют все более высокие оценки функциональной важности.) Ни один из методов, основанных на последовательностях, не может идентифицировать истинные функциональные сайты, потому что последовательности, которые соответствуют этой конкретной структурной складке, являются высококонсервативными, и многие остатки в двух листах имеют относительно высокие оценки консервативности.Однако, поскольку все остатки в двух бета-листах находятся в непосредственной близости друг от друга, оценки RAPDF с большей вероятностью будут обладать дискриминирующей силой для выявления неблагоприятных контактов остаток-остаток и прояснения серьезных ограничений на возможные замены аминокислот. Следовательно, дополнительное использование структурной информации помогает правильно идентифицировать более важные остатки методом MFS.

    Эффективность MFS для понимания взаимодействий белковых доменов.

    MFS также можно использовать вручную, чтобы получить представление о структуре и функциях не охарактеризованных белков, тем самым облегчая создание гипотез для биохимических экспериментов.Ранее мы сообщали о наличии двух тубулиноподобных генов, бактериального тубулина a ( btuba ) и бактериального тубулина b ( btubb ) у бактерий Prosthecobacter dejongeii [52]. У эукариот α и β тубулины образуют димеры, и димеры соединяются друг с другом с образованием олигомеров, которые удлиняются с образованием протофиламентов. Протофиламенты составляют цитоскелет микротрубочек, который присутствует у всех известных эукариот, но не у бактерий или архей. Следовательно, присутствие тубулиноподобных генов btuba и btubb у видов бактерий вызвало большое любопытство в отношении их потенциальных структурных и функциональных ролей, а также их эволюционного происхождения [52].В нашей предыдущей публикации мы выполнили предсказание структуры на основе моделирования гомологии с использованием димера эукариотического α / β-тубулина в качестве шаблона. Мы проанализировали предсказанную димерную структуру с использованием показателей RAPDF и пришли к выводу, что btuba и btubb вряд ли образуют димеры в бактериях из-за структурных дестабилизирующих эффектов нескольких аминокислотных остатков в границах раздела димеров, которые различаются между btuba / btubb и эукариотические тубулины [52].Это открытие было дополнительно подтверждено тем фактом, что данные электронной микроскопии не продемонстрировали наличие микротрубочноподобных структур у Prosthecobacter dejongeii [52]. Однако в 2005 г. кристаллические структуры butba и btubb были решены в E.coli , показав, что btuba и btubb образуют димеры [53]. Кроме того, анализ сборки in vitro в E.coli продемонстрировал, что btuba и btubb образуют протофиламенты, содержащие равные концентрации btuba и btubb , что позволяет предположить, что две субъединицы имеют альтернативное расположение вдоль протофиламенты [54].Поэтому мы тщательно пересмотрели, почему наши предыдущие предсказания относительно образования димеров были ошибочными.

    Мы сначала сравнили нашу предсказанную структуру в 2002 году с экспериментальной структурой, которая была решена в 2005 году, и обнаружили, что предсказания структуры достаточно точны: C α RMSD для btuba (433 остатка) и btubb (426 остатков). между предсказанными и экспериментальными структурами 2,28 Å и 2,36 Å соответственно. Затем мы сгенерировали метафункциональные сигнатуры для димера btuba / btubb , используя предсказанную структуру (рис. 4, слева).В нашем протоколе генерации MFS используется немного другая оценка структурной стабильности (RAPDF с 37 ячейками [32]), чем в предыдущей публикации, RAPDF с 18 ячейками [30]. Изучая оценки структурной стабильности интерфейса димера, мы подтвердили наши предыдущие предсказания, что димерные структуры со специфическими для бактерий заменами, такими как G100, менее стабильны [52]. Однако, исследуя 10 остатков с наивысшими показателями MFS (20 остатков, изображенных в виде красных сфер в димере) во всей структуре, мы четко различаем кластер остатков с высокими показателями, окружающий GDP на границе раздела димера.Показатели MFS подтверждают гипотезу о том, что интерфейс димера действительно функционально важен и связывается с молекулами GDP, в отличие от прогнозов, полученных только на основе структурной стабильности. Этот пример дополнительно подчеркивает важность использования метафункциональных сигнатур, а не только показателей структурной стабильности при интерпретации структурных и функциональных ролей отдельных аминокислотных остатков. Другими словами, хотя была создана высокоточная модель атомного разрешения, функциональные сайты не были точно предсказаны до тех пор, пока мы не оценили информацию об эволюции и последовательности.Специфично для этой проблемы, мы находим кластеры с высокими показателями в голове btuba и хвосте btubb , косвенно предполагая, что хвост btubb может связываться с головкой btuba в другом димере. Следовательно, расчет MFS не только поддерживает образование димеров, но также и последовательное добавление димеров с образованием протофиламентов, что подтверждается биохимическими экспериментами [54].

    Рисунок 4. Применение MFS для понимания роли димера btuba / btubb в бактериальном роду Prosthecobacter с использованием предсказанных и экспериментальных структур.

    Обе структуры окрашены посредством изображения остатков с более высокой оценкой MFS более интенсивным красным цветом, при этом 10 наиболее высоко оцениваемых остатков представлены сферами. Один GTP и один GDP в прогнозируемой структуре, а также один GDP и два иона SO 4 2- в экспериментальной структуре показаны желтыми сферами. Предсказанная структура генерируется методами моделирования гомологии с использованием димера эукариотических альфа / бета тубулина (идентификатор PDB: 1jff) в качестве шаблона. Таксоловый лиганд и ионы металлов опущены в предсказанной структуре для облегчения описания.В предсказанной структуре btubb лежит выше btubb , с молекулой GDP, заключенной на границе раздела димеров. В экспериментальной структуре (идентификатор PDB: 2btq) btuba лежит выше btubb , и GDP на границе раздела димеров отсутствует. Наш анализ MFS сначала подтвердил, что btuba и btubb действительно образуют димеры из-за существования кластера с высокими показателями на границе их димеров, в отличие от предыдущих предсказаний, сделанных с использованием только показателя структурной стабильности.Кроме того, MFS предполагает, что независимо от того, как btuba и btubb ориентируются друг с другом, их интерфейс является функционально важным и может связываться с молекулами GDP.

    https://doi.org/10.1371/journal.pcbi.1000181.g004

    Затем мы исследовали экспериментальные структуры для димера btuba / butbb и рассчитали метафункциональные сигнатуры для димера (рис. 4, справа). Неожиданно мы обнаружили, что экспериментальная структура димера btuba / btubb отличается от нашей предсказанной структуры (а также экспериментальной структуры димера эукариотического тубулина) относительным положением димерных субъединиц.В димере эукариот, когда GDP-связывающий домен α- и β-тубулина ориентирован на север, α-тубулин располагается выше β-тубулина, так что α-тубулин связывается с GDP в нуклеотид-связывающем домене β-тубулина. Напротив, в экспериментальной структуре бактерий тубулина btuba лежит выше btubb , и на их границе раздела нет молекулы GDP, но вместо этого есть два иона SO 4 2- (показаны двумя маленькими желтыми сферы). Тем не менее, посредством анализа MFS мы все же обнаружили кластер высоко оцениваемых остатков на границе раздела btuba / butbb в экспериментальных структурах, указывая на то, что этот интерфейс может быть функционально важным сайтом связывания.Учитывая относительно большой промежуток между btuba и btubb на границе раздела димеров в экспериментальной структуре, существование двух ионов SO 4 2-, которые очень похожи на две фосфатные группы в GDP, и кластер высоких -счетные остатки, предложенные анализом MFS, вместе эти свидетельства указывают на сходные паттерны взаимодействия между btuba / btubb в бактериях и α / β тубулином у эукариот, несмотря на их различия в сборке, что может быть связано с артефактами кристаллографии и / или из-за к недостаточной концентрации молекул GDP в растворе.

    Наконец, вычисляя метафункциональные сигнатуры для экспериментальных и предсказанных структур для btuba и btubb , мы идентифицировали несколько аминокислотных мутаций, которые дают самые высокие оценки MFS для димерной структуры. Таким образом, метафункциональные сигнатуры предполагают конкретные аминокислоты, которые могут быть введены в виде мутаций в тубулины Prosthecobacter dejongeii для функциональной характеристики (в противном случае это заняло бы много часов ручного анализа).Детальные биохимические эксперименты и эксперименты по мутагенезу продолжаются для этих предсказанных важных мутаций. Этот тип подробного (и ориентированного на конкретную проблему) анализа — это то, как, по нашему мнению, можно использовать MFS для получения критического понимания роли определенных аминокислот в функции белков и для руководства экспериментальной работой.

    Характеристика редких механизмов функции белков с помощью MFS.

    Мы также применили MFS для характеристики механизмов белков, функции которых существенно отличаются от функций в обучающих наборах, которые ограничены каталитическими сайтами и сайтами связывания белок-лиганд.Связывание белков с биоминеральными поверхностями — это плохо изученный процесс. Одним из немногих белков млекопитающих, которые, как известно, связывают гидроксиапатитную поверхность кости, и единственный, для которого механизм был охарактеризован на атомном уровне, является остеокальцин, который, таким образом, представляет собой пример применимости MFS для прогнозирования редких механизмов функции белков.

    Дифракционная структура остеокальцина (идентификатор PDB: 1q8h) [55] демонстрирует задействованные специфические остатки и иллюстрирует механизм давно известной функции связывания с поверхностью гидроксиапатита кости [56].Специфическое размещение ионов кальция вдоль внешней поверхности белка соответствует конформации ионов кальция вдоль открытой поверхности гидроксиапатита в кости [55]. Как самый распространенный неколлагеновый белок в кости [57], остеокальцин регулирует формирование кости [58], и недавно было показано, что он играет ключевую роль в эндокринной регуляции системного метаболизма [59].

    Среди пяти лучших результатов SeqonlyMFS успешно идентифицировал три известных гидроксиапатит-связывающих остатка остеокальцина (17E-21E-24E), а две другие пять лучших оценок выделили два цистеина, участвующих в стабилизирующем складку дисульфидном мостике (23C – 29C; рис. 5).Полный MFS создает аналогичное распределение наивысшего функционального значения, но увеличивает оценку тирозина (42Y) над двумя остатками, связывающими гидроксиапатит. Из-за этого высокого показателя MFS мы полагаем, что 42Y представляет собой фосфорилированный остаток (а не три других тирозина), регулирующий клеточную сигнальную функцию для остеокальцина, что было показано противоположным действием на функцию поджелудочной железы у мышей, лишенных остеокальцина, по сравнению с мышами, у которых отсутствует белок. тирозинфосфатаза OST-PTP [59].Немного сниженная селективность связывающих остатков гидроксиапатита при включении показателей структурной стабильности также соответствует уменьшенному влиянию мутаций на стабильность, когда функциональные боковые цепи присутствуют вдоль свободной внешней поверхности белка, а не внутри компактной каталитической щели. Здесь строгость MFS демонстрируется сохранением всех этих остатков в топ-10, несмотря на небольшое влияние на нестабильность. Хотя функциональные остатки в белке включают три глутаминовые кислоты, которые часто представлены как функциональные сайты в наборах данных для обучения, мы отмечаем, что MFS и SeqonlyMFS предоставляют дополнительную информацию только к информации об идентичности аминокислот: во-первых, в белке еще есть пять глутаминовых кислот. только три действительных функциональных сайта были выбраны как MFS, так и SeqonlyMFS; во-вторых, два цистеина, которые образуют дисульфидный мостик, были правильно идентифицированы как высокоэффективные остатки как MFS, так и SeqonlyMFS, но цистеины редко представлены как функциональные сайты в наших наборах данных для обучения.Следовательно, одной лишь идентичности аминокислот недостаточно для вывода функционально важных остатков для этого белка.

    Рисунок 5. Прогноз остатков с редкой функцией, не представленной в обучающих наборах.

    MFS обучили на наборе остатков, экспериментально охарактеризованных для участия в канонических каталитических функциях и интерфейсах белок-лиганд. Связывание белков с биоминеральными поверхностями является редкой функцией и плохо изученным процессом, для которого единственной доступной дифракционной структурой являются ионы металла, связывающие остеокальцин (изображенные в виде зеленых сфер с ионными связями с остатками γ-карбоксиглутаминовой кислоты (gla) в прозрачной зеленой пробирке) (Идентификатор PDB: 1q8h).Три остатка gla остеокальцина (представленные в виде сфер, подобных целевым остаткам на Рисунке 3 выше), ранее показанные для связывания с гидроксиапатитной поверхностью кости, явно выбираются MFS в пределах шести верхних из 49 остатков, с или без знания структурных и посттрансляционная модификация этих остатков. Эти остатки отобраны ConSurf из восьми с гораздо меньшим различием оценок других остатков в остеокальцине. Ни один из этих остатков не выбран ET в топ-10.Этот пример демонстрирует применимость MFS для высокоточных и конкретных прогнозов для белков с самыми разными функциями.

    https://doi.org/10.1371/journal.pcbi.1000181.g005

    Для сравнения, метод Evolutionary Trace не позволяет выделить связывающие гидроксиапатит остатки в 10 лучших баллов, оценивая их с четырнадцатого по шестнадцатый из тридцати семи. считается из конструкции. Между тем, метод ConSurf выбирает эти остатки в пределах восьми наивысших баллов, но обеспечивает гораздо более слабое различение от остальной части белка.Значительное падение оценок происходит после первых шести оценок в обоих распределениях MFS, в то время как более двух третей остатков оцениваются в пределах этого диапазона падения для ConSurf. Это различие в способности различать ясно видно из рисунка 5.

    Функциональные α-карбоксиглутаминовые кислоты, обнаруженные методами на основе последовательностей в MFS, были упрощены во всех предсказаниях как глутаминовые кислоты в соответствии с кодирующими нуклеотидными последовательностями, так что посттрансляционная модификация не рассматривалась.Этот пример демонстрирует, что MFS можно надежно использовать для идентификации функциональных остатков, даже если структура и посттрансляционные модификации неизвестны, а остатки не участвуют в канонических каталитических реакциях или взаимодействиях белок-лиганд. Идентификация этих модифицированных остатков указывает на то, что MFS непосредственно полезен для предсказания сайтов посттрансляционной модификации. Наконец, структурное упрощение, используемое в нашем анализе, объясняет более слабую дискриминацию этих функциональных остатков при рассмотрении структуры, поскольку экспериментальная структура дестабилизируется из-за увеличенного объема и отрицательного заряда боковых цепей α-карбоксиглутаминовой кислоты.

    Уточнение выравниваний для сравнительного моделирования.

    Мы исследовали использование MFS для помощи в создании парных выравниваний для отдаленно родственных белков. Создание точных парных выравниваний важно для предсказания структуры белка с использованием методов моделирования гомологии, потому что обычно первым шагом в моделировании гомологии является копирование атомных координат целевого белка в запрашиваемый белок для всех выровненных остатков. Некоторые из лучших выравниваний производятся сервером 3D-Jury [60], который представляет собой мета-сервер, который собирает информацию о выравнивании, а также оценивает информацию от многих отдельных серверов для выравнивания структуры последовательности и генерирует согласованное попарное выравнивание.Один из белков, над которым мы работали, — это белок dtx с 639 остатками. Мы отправили последовательность запросов на сервер 3D-Jury, чтобы определить экспериментальную структуру, которая имеет наилучшую оценку соответствия запросу. Мы использовали выравнивание с наивысшей оценкой 3D-жюри для структурного моделирования. Один сегмент созданного нами попарного выравнивания:

    Запрос: GIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYA

    Цель: GIAEQHAMTSAAGLAMGG – LHPVVAIYSTFLNRA

    Однако, когда мы вычисляем SeqonlyMFS как для запрашиваемого белка, так и для целевого белка, мы обнаружили, что как «H» (гистидины) в запросе, так и целевая последовательность входят в десятку наиболее высоко оцениваемых остатков.Эта функциональная сигнатура предполагает, что может быть ошибка выравнивания; следовательно, лучшее согласование, основанное на функциональных доказательствах:

    Запрос: GIRE-HAMGAIMNGISAFGANYKPYGGTFLNFVSYA

    Цель: GIAEQHAMTSAAGLAMGG — LHPVVAIYSTFLNRA

    , который вводит два дополнительных пробела (обычно нежелательных для моделирования структуры), но выравнивает функционально важные остатки друг с другом. Наличие более точных трехмерных координат для функционально важных остатков и областей будет особенно важно в последующем функциональном анализе и генерации гипотез для предсказанных структур.Поскольку экспериментальная структура для этого белка еще не доступна, мы не смогли дополнительно подтвердить точность MFS-скорректированных выравниваний со структурной точки зрения. Вышеупомянутая процедура является просто примером ручной корректировки парных выравниваний для удаленно связанных белков; однако при более сложной разработке алгоритмов станет возможным генерировать функциональные выравнивания, в отличие от выравниваний последовательностей или структур, в автоматическом режиме для двух белков с функциями, которые представлены несколькими векторами переменной длины.В таких случаях, вместо предсказания функциональных остатков, MFS-подобная процедура может использоваться для переноса аннотации между двумя белками. Фактически, ключевые функциональные особенности белковых структур уже использовались для улучшения передачи аннотаций между ферментами [61]. Такие функциональные выравнивания были бы полезны как для предсказания структуры, так и для функциональных исследований неохарактеризованных белков.

    Обсуждение

    В этой работе мы описываем протокол генерации метафункциональной сигнатуры (MFS), который объединяет несколько источников информации для предсказания функционального сайта белка.Мы также демонстрируем способность этого протокола характеризовать функцию белка на основе остатков, используя четыре реальных примера.

    Ключевые идеи, представленные в этом исследовании, включают разделение структурного и функционального вкладов, использование псевдоэнергетических функций для мутированных структур для определения их влияния на функцию белка и сочетание основанных на знаниях и биофизических подходов для всестороннего аннотирования функциональное значение остатков в последовательности белка.Большинство компонентов нашего подхода не уникальны: другие алгоритмы прогнозирования функций используют множественное выравнивание последовательностей, информацию из базы данных, а также экспериментальные и предсказанные структуры белков. Одним из уникальных аспектов нашего подхода является интеграция всех компонентов в единую структуру, основанную на знаниях и структуре, которая может обеспечивать более точные и полные прогнозы, но каждый компонент также может обеспечивать различные аспекты биологического понимания интерпретации белка. функция.

    Поскольку в нашем исследовании использовались два разных набора данных (набор Торнтона и набор Ловелла) из разных источников, мы хотим сравнить и обсудить здесь параметры модели для разных наборов данных. Этот анализ может помочь нам понять относительный вклад различных компонентов оценки в двух наборах данных. Чтобы учесть различную величину переменных-предикторов, мы вычислили наклон коэффициента регрессии при преобразовании всех предикторов в Z-баллы.Для набора данных Thornton наклон для нормализованных HMM_rel_ent, SSR, RAPDF_spread и RAPDF_dif составляет 1,1, 0,25, 0,52 и 0,23 соответственно; для набора данных Lovell соответствующие значения равны 1,1, 0,28, 0,45 и 0,19 соответственно. Следовательно, для набора данных Thornton, который содержит каталитические сайты, модель содержит немного больший вклад от оценок на основе структуры, что указывает на то, что структурная информация относительно более важна для определения каталитических сайтов, чем интерфейсы связывания.Кроме того, мы также сравнили относительный вклад 20 аминокислот в модель. Для набора данных Thornton пять аминокислот с наибольшим вкладом — это Glu, Lys, Asp, Arg и Ser, соответственно, с нормализованными коэффициентами в диапазоне от 0,55 до 0,83. Для набора данных Ловелла пять аминокислот с наибольшим вкладом также являются Glu, Lys, Asp, Arg и Ser, соответственно, с нормализованными коэффициентами в диапазоне от 0,66 до 0,84. Таким образом, идентичность аминокислот, по-видимому, играет одинаково важную роль в этих двух наборах данных.Мы отмечаем, что «функциональные остатки» в контексте этого исследования представляют собой как каталитические сайты, так и сайты связывания, однако из-за ограничений источников данных каждый набор тестовых данных содержит только часть истинных функциональных сайтов, поэтому некоторые истинно положительные результаты могут быть неправильно обрабатываются как нефункциональные сайты в каждом наборе данных. Помимо сравнения двух наборов данных, чтобы оценить стабильность регрессионных моделей, мы также выполнили аналогичный анализ, сравнив пять наборов моделей, используемых в экспериментах с перекрестной проверкой, и обнаружили, что параметры модели в основном идентичны между перекрестными проверками (данные не показано).

    Хотя мы представили MFS как набор компонентов скоринга, интегрированных простой моделью логистической регрессии, альтернативным способом интеграции информации является использование сложного подхода машинного обучения, например, с помощью алгоритмов на основе SVM. Мы исследовали эту проблему, но решили использовать регрессионную модель по нескольким причинам: во-первых, хотя хорошо известно, что SVM хорошо работает с задачами бинарной классификации, она страдает отсутствием «биологической» интерпретации. Например, Петрова и др. Оценили 26 различных алгоритмов / классификаторов в программном пакете WEKA и представили лучшую комбинацию компонентов в виде набора семи (из 24) свойств остатков для прогнозирования каталитических остатков [37].Кроме того, Юн и др. Протестировали SVM на 314 различных функциях, продемонстрировали, что совместное использование нескольких функций улучшает производительность, и представили функции с наиболее высоким рейтингом [39]. Pugalenthi et al. протестировали 278 различных функций для предсказания каталитических сайтов и исследовали производительность при использовании подмножества из 50–250 функций [40]. Хотя эти подходы к машинному обучению обычно приводят к повышению производительности, трудно декодировать эти методы «черного ящика» и использовать отдельный компонент (из десятков или сотен) для интерпретации различных аспектов биологической функции, как мы это сделали с MFS на четыре реальных примера.Следовательно, в этих случаях простая модель логистической регрессии является концептуально лучшим выбором, где параметры регрессии легко понятны. Во-вторых, функциональная важность может быть эффективно отражена несколькими в значительной степени независимыми характеристиками в простой линейной модели, не прибегая к тестированию многих более сложных моделей и выбору наиболее эффективной модели. Например, на рисунке 1 Петровой и др., Хотя SVM оценивается выше, чем логистическая регрессия при сравнении множества различных алгоритмов, производительность этих двух методов действительно очень схожа.Поэтому мы полагались на простую модель логистической регрессии как на лучший подход для представления и интеграции ансамбля методов, основанных на знаниях и биофизике, в MFS.

    MFS — это больше, чем просто еще один алгоритм прогнозирования функционального сайта, он может использоваться как способ определения функции белка с помощью ряда количественных значений, отражающих функциональную важность белка. Абстрагируя функцию белка в вектор (или несколько векторов, если каждый отдельный компонент рассматривается отдельно), можно применять более сложные алгоритмы для более эффективного использования этой информации.Традиционно два белка могут быть выровнены вместе на основании сходства их последовательностей, сходства структур или совместимости последовательности-структуры. Однако введение концепции MFS позволяет генерировать функциональное выравнивание между двумя белками. Например, мы продемонстрировали, что, сравнивая оценки MFS для двух белков, мы потенциально можем улучшить точность выравнивания, используя функциональные сигнатуры вручную. Однако автоматический алгоритм выравнивания двух матриц переменной длины нетривиален.Необходимы усовершенствования алгоритмов, чтобы найти оптимальное решение для автоматического функционального выравнивания двух белков. Мы активно ищем приблизительные решения этой проблемы.

    Помимо методов идентификации функциональных сайтов, используемых в статье, мы понимаем, что существует множество других различных типов методов для идентификации важных остатков из последовательности или структуры белка. Многие из методов основаны на непрерывной последовательности аминокислотных паттернов, например паттерн PROSITE [62] и паттерн BLOCKs [63].Все остатки в данном белке, которые соответствуют определенным мотивам, считаются функционально важными, и свойства мотивов также могут указывать на определенные функциональные роли белка. Однако эти методы обычно приводят к значительному завышенному предсказанию остатков «функционального сайта»; например, некоторые паттерны PROSITE состоят из мотивов с 3 остатками, которые соответствуют множеству сайтов в множестве белков. Следовательно, хотя эти методы полезны для подтверждения наличия паттерна, соответствующего биологической функции, или для генерации гипотез для прогнозирования возможной функциональной категории, эти методы обычно слишком общие для определения функциональной важности на уровне остатков.Мы рассматриваем наш метод и методы сканирования мотивов как идеологически разные методологии решения схожих задач. Вместе они могут помочь пользователям получить дополнительную биологическую информацию для характеристики белков.

    Протокол генерации MFS можно улучшить несколькими способами. Одним из преимуществ концепции MFS является то, что она состоит из нескольких независимых модулей, поэтому каждый модуль можно обновлять и улучшать без нарушения функциональности других модулей. Мы улучшаем производительность MFS во многих аспектах.Во-первых, в то время как многие другие веб-серверы (например, SIFT) используют весь NR или всю коллекцию последовательностей TrEMBL, мы использовали только данные Uniref90, что позволило нам ускорить поиск BLAST. Однако набор данных Uniref90 не самого высокого качества. Существует много чрезвычайно коротких последовательностей, которые можно легко включить в выравнивание, а многие неизвестные аминокислоты аннотированы как длинные отрезки «X». Кроме того, мы использовали программу PSI-BLAST для сканирования базы данных последовательностей и генерации нескольких выравниваний, которые на самом деле являются просто версией множества попарных выравниваний.Создание более точных множественных выравниваний поможет при оценке сохранности на основе последовательностей и выводах о филогении. Кроме того, расчет RAPDF для мутированных структур также может быть оптимизирован. Необязательный шаг после замены боковой цепи — минимизация энергии за счет глобального возмущения структуры. Этот шаг может быть реализован с помощью протокола ENCAD [48]. Поскольку эта процедура значительно увеличивает время выполнения, мы сделали ее необязательным шагом. Более быстрое создание более точных оценок структурной стабильности для мутировавших структур улучшило бы производительность MFS.Дальнейшая разработка и оптимизация текущего протокола значительно улучшат функциональную аннотацию пространства последовательностей и структур.

    Помимо повышения эффективности прогнозирования функционального сайта белка, оценки MFS, рассматриваемые как векторы, могут использоваться для различения функциональных категорий для данного белка (например, назначение суперсемейства SCOP [35], [64] или узла GO в иерархии GO ). Анализ MFS также выявляет функциональную важность на уровне остатков, что позволяет проводить рациональный мутагенез и биохимические эксперименты.Наконец, метод MFS может быть использован для изменения функции белка, что приведет к его применению в дизайне белков и открытии лекарств. Применение протоколов MFS во многих областях вычислительной биологии и биоинформатики, как показано на примерах в статье, может значительно продвинуть наше понимание взаимосвязи между структурой и функцией белка и направить экспериментальную характеристику функции белка.

    Благодарности

    Мы благодарим Рене Иретон за критическое прочтение и редактирование рукописи.Мы также хотим поблагодарить членов группы вычислительной биологии Samudrala за полезные обсуждения и комментарии.

    Вклад авторов

    Задумал и спроектировал эксперименты: RS. Проведенные эксперименты: KW. Проанализированы данные: KW JAH. Предоставленные реагенты / материалы / инструменты анализа: GC DCN. Написал статью: KW.

    Ссылки

    1. 1. Watson JD, Laskowski RA, Thornton JM (2005) Предсказание функции белка на основе данных последовательности и структуры.Curr Opin Struct Biol 15: 275–284.
    2. 2. Whisstock JC, Lesk AM (2003) Прогнозирование функции белка на основе последовательности и структуры белка. Q Rev Biophys 36: 307–340.
    3. 3. Фридберг I (2006) Автоматизированное предсказание функции белков — геномная проблема. Краткая биография 7: 225–242.
    4. 4. Webb EC (1992) Enzyme Nomenclature 1992. Сан-Диего (Калифорния): Academic Press.
    5. 5. Эшбернер М., Болл К.А., Блейк Дж. А., Ботштейн Д., Батлер Н. и др.(2000) Генная онтология: инструмент для объединения биологии. Нат Генет 25: 25–29.
    6. 6. Андреева А., Ховорт Д., Бреннер С.Е., Хаббард Т.Дж., Чотия С.и др. (2004) База данных SCOP в 2004 году: уточнения объединяют данные о структуре и семействе последовательностей. Нуклеиновые кислоты Res 32: D226 – D229.
    7. 7. Валдар В.С. (2002) Сохранение остатков в баллах. Белки 48: 227–241.
    8. 8. Sander C, Schneider R (1991) База данных гомологичных белковых структур и структурное значение выравнивания последовательностей.Белки 9: 56–68.
    9. 9. Шенкин П.С., Эрман Б., Мастрандреа Л.Д. (1991) Теоретико-информационная энтропия как мера изменчивости последовательности. Белки 11: 297–313.
    10. 10. Williamson RM (1995) Информационно-теоретический анализ взаимосвязи между структурой первичной последовательности и узнаванием лиганда среди класса облегченных переносчиков. Дж. Теор Биол 174: 179–188.
    11. 11. Мирный Л.А., Шахнович Е.И. (1999) Универсально консервативные позиции в белковых складках: считывание эволюционных сигналов о стабильности, кинетике складывания и функции.J Mol Biol 291: 177–196.
    12. 12. Plaxco KW, Larson S, Ruczinski I., Riddle DS, Thayer EC, et al. (2000) Эволюционная консервация кинетики сворачивания белков. J Mol Biol 298: 303–312.
    13. 13. Герштейн М., Альтман Р. Б. (1995) Средние основные структуры и меры вариабельности для семейств белков: применение к иммуноглобулинам. J Mol Biol 251: 161–175.
    14. 14. Пей Дж, Дохолян Н.В., Шахнович Е.И., Гришин Н.В. (2003) Использование дизайна белков для обнаружения гомологии и поиска активных сайтов.Proc Natl Acad Sci U S A 100: 11361–11366.
    15. 15. Валдар В.С., Торнтон Дж. М. (2001) Интерфейсы белок-белок: анализ консервации аминокислот в гомодимерах. Белки 42: 108–124.
    16. 16. Гривз Р., Уорвикер Дж. (2005) Идентификация активного сайта с помощью расчетов на основе геометрии и профиля последовательности: захоронение каталитических щелей. J Mol Biol 349: 547–557.
    17. 17. Пей Дж., Гришин Н.В. (2001) AL2CO: расчет позиционной консервативности при выравнивании белковой последовательности.Биоинформатика 17: 700–712.
    18. 18. Capra JA, Singh M (2007) Предсказание функционально важных остатков на основе сохранения последовательности. Биоинформатика 23: 1875–1882.
    19. 19. Ван К., Самудрала Р. (2006) Включение фоновой частоты улучшает меры по сохранению остатков на основе энтропии. BMC Bioinformatics 7: 385
    20. 20. Lichtarge O, Bourne HR, Cohen FE (1996) Метод эволюционного отслеживания определяет поверхности связывания, общие для семейств белков.J Mol Biol 257: 342–358.
    21. 21. Яо Х., Кристенсен Д.М., Михалек И., Сова М.Э., Шоу С. и др. (2003) Точный, чувствительный и масштабируемый метод определения функциональных сайтов в белковых структурах. J Mol Biol 326: 255–261.
    22. 22. Mihalek I, Res I, Lichtarge O (2006) Evolutionary trace report_maker: новый тип сервиса для сравнительного анализа белков. Биоинформатика 22: 1656–1657.
    23. 23. Mihalek I, Res I, Lichtarge O (2004) Семейство эволюционно-энтропийных гибридных методов для ранжирования белковых остатков по важности.J Mol Biol 336: 1265–1282.
    24. 24. Ландау М., Мэйроуз I, Розенберг Й., Глейзер Ф., Мартц Э. и др. (2005) ConSurf 2005: прогноз эволюционной сохранности остатков в белковых структурах. Нуклеиновые кислоты Res 33: W299 – W302.
    25. 25. Глейзер Ф., Пупко Т., Паз I, Белл Р.Е., Бехор-Шентал Д. и др. (2003) ConSurf: идентификация функциональных областей в белках путем картирования поверхности филогенетической информации. Биоинформатика 19: 163–164.
    26. 26.Soyer OS, Goldstein RA (2004) Предсказание функциональных сайтов в белках: сайт-специфические эволюционные модели и их применение к транспортерам нейротрансмиттеров. J Mol Biol 339: 227–242.
    27. 27. La D, Sutch B, Livesay DR (2005) Предсказание функциональных сайтов белков с филогенетическими мотивами. Белки 58: 309–320.
    28. 28. del Sol Mesa A, Pazos F, Valencia A (2003) Автоматические методы прогнозирования функционально важных остатков. J Mol Biol 326: 1289–1302.
    29. 29. Dessailly BH, Lensink MF, Wodak SJ (2007) Связывание дестабилизирующих областей с известными функциональными сайтами в белках. BMC Bioinformatics 8: 141.
    30. 30. Samudrala R, Moult J (1998) Всеатомная зависимая от расстояния условная дискриминирующая функция вероятности для предсказания структуры белка. J Mol Biol 275: 895–916.
    31. 31. Ван К., Фейн Б., Левитт М., Самудрала Р. (2004) Улучшенный выбор структуры белка с использованием зависимых от приманки дискриминационных функций.BMC Struct Biol 4: 8.
    32. 32. Лю Т., Самудрала Р. (2006) Влияние экспериментального разрешения на выполнение основанных на знаниях дискриминационных функций для выбора структуры белка. Protein Eng Des Sel 19: 431–437.
    33. 33. Hung LH, Ngan SC, Liu T, Samudrala R (2005) PROTINFO: новые алгоритмы для улучшенного предсказания структуры белка. Нуклеиновые кислоты Res 33: W77-W80.
    34. 34. Chelliah V, Chen L, Blundell TL, Lovell SC (2004) Выявление структурных и функциональных ограничений в эволюции с целью выявления мест взаимодействия.J Mol Biol 342: 1487–1504.
    35. 35. Ван К., Самудрала Р. (2005) FSSA: новый метод определения функциональных сигнатур по структурным согласованиям. Биоинформатика 21: 2969–2977.
    36. 36. Cheng G, Qian B, Samudrala R, Baker D (2005) Улучшение предсказания функционального сайта белка путем выделения структурных и функциональных ограничений на эволюцию семейства белков с использованием вычислительного дизайна. Nucleic Acids Res 33: 5861–5867.
    37. 37. Петрова Н.В., Ву СН (2006) Прогнозирование каталитических остатков с помощью машины опорных векторов с выбранной последовательностью белка и структурными свойствами.BMC Bioinformatics 7: 312.
    38. 38. Fischer JD, Mayer CE, Soding J (2008) Прогнозирование функциональных остатков белка на основе последовательности путем оценки плотности вероятности. Биоинформатика 24: 613–620.
    39. 39. Youn E, Peters B, Radivojac P, Mooney SD (2007) Оценка характеристик для предсказания каталитических остатков в новых складках. Protein Sci 16: 216–226.
    40. 40. Pugalenthi G, Kumar KK, Suganthan PN, Gangal R (2008) Идентификация каталитических остатков из структуры белка с использованием машины опорных векторов с последовательностью и структурными особенностями.Biochem Biophys Res Commun 367: 630–634.
    41. 41. Tang YR, Sheng ZY, Chen YZ, Zhang Z (2008) Улучшенное предсказание каталитических остатков в структурах ферментов. Protein Eng Des Sel 21: 295–302.
    42. 42. Wu CH, Apweiler R, Bairoch A, Natale DA, Barker WC, et al. (2006) Универсальный белковый ресурс (UniProt): расширяющаяся вселенная информации о белках. Нуклеиновые кислоты Res 34: D187 – D191.
    43. 43. Альтшул С.Ф., Мэдден Т.Л., Шаффер А.А., Чжан Дж., Чжан З. и др.(1997) Gapped BLAST и PSI-BLAST: новое поколение программ поиска в базе данных белков. Nucleic Acids Res 25: 3389–3402.
    44. 44. Eddy SR (1998) Профиль скрытых марковских моделей. Биоинформатика 14: 755–763.
    45. 45. ФИЛИП http://evolution.genetics.washington.edu/phylip.html.
    46. 46. Самудрала Р., Левитт М. (2002) Всесторонний анализ 40 слепых предсказаний структуры белка. BMC Struct Biol 2: 3.
    47. 47. Канутеску А.А., Шеленков А.А., Данбрак Р.Л. мл. (2003) Алгоритм теории графов для быстрого предсказания боковой цепи белка.Protein Sci 12: 2001–2014.
    48. 48. Левитт М., Хиршберг М., Шарон Р., Даггетт В. (1995) Функция и параметры потенциальной энергии для моделирования молекулярной динамики белков и нуклеиновых кислот в растворе. Comput Phys Commun 91: 215–231.
    49. 49. Райс П., Лонгден И., Близби А. (2000) EMBOSS: Открытый программный пакет европейской молекулярной биологии. Тенденции Genet 16: 276–277.
    50. 50. Porter CT, Bartlett GJ, Thornton JM (2004) Атлас каталитических сайтов: ресурс каталитических сайтов и остатков, идентифицированных в ферментах с использованием структурных данных.Нуклеиновые кислоты Res 32: D129 – D133.
    51. 51. Петтерсен Э.Ф., Годдард Т.Д., Хуанг С.С., Коуч Г.С., Гринблатт Д.М. и др. (2004) UCSF Chimera — система визуализации для поисковых исследований и анализа. J Comput Chem 25: 1605–1612.
    52. 52. Дженкинс С., Самудрала Р., Андерсон И., Хедлунд Б.П., Петрони Дж. И др. (2002) Гены цитоскелетного белка тубулина у бактерий рода Prosthecobacter. Proc Natl Acad Sci U S A 99: 17049–17054.
    53. 53. Schlieper D, Oliva MA, Andreu JM, Lowe J (2005) Структура бактериального тубулина BtubA / B: доказательства горизонтального переноса генов.Proc Natl Acad Sci U S A 102: 9170–9175.
    54. 54. Sontag CA, Staley JT, Erickson HP (2005) Сборка in vitro и гидролиз GTP бактериальными тубулинами BtubA и BtubB. J Cell Biol 169: 233–238.
    55. 55. Hoang QQ, Sicheri F, Howard AJ, Yang DS (2003) Механизм распознавания костей остеокальцина свиньи по кристаллической структуре. Природа 425: 977–980.
    56. 56. Poser JW, Price PA (1979) Метод декарбоксилирования γ-карбоксиглутаминовой кислоты в белках.Свойства декарбоксилированного белка γ-карбоксиглутаминовой кислоты из костей теленка. J Biol Chem 254: 431–436.
    57. 57. Hauschka PV, Lian JB, Cole DE, Gundberg CM (1989) Остеокальцин и матричный белок Gla: витамин К-зависимые белки в кости. Physiol Rev 69: 990–1047.
    58. 58. Ducy P, Desbois C, Boyce B, Pinero G, Story B и др. (1996) Повышенное костеобразование у мышей с дефицитом остеокальцина. Nature 382: 448–452.
    59. 59. Ли Н.К., Сова Х., Хинои Э., Феррон М., Ан Дж. Д. и др.(2007) Эндокринная регуляция энергетического обмена скелетом. Cell 130: 456–469.
    60. 60. Гинальски К., Элофссон А., Фишер Д., Рыхлевски Л. (2003) 3D-Jury: простой подход для улучшения предсказаний структуры белка. Биоинформатика 19: 1015–1018.
    61. 61. Уорд Р.М., Эрдин С., Тран Т.А., Кристенсен Д.М., Лисевски А.М. и др. (2008) Деорфанизация структурного протеома путем взаимного сравнения эволюционно важных структурных особенностей. PLoS ONE 3: e2136.
    62. 62. Хуло Н., Байрох А., Буллиард В., Серутти Л., Де Кастро Е. и др. (2006) База данных PROSITE. Нуклеиновые кислоты Res 34: D227 – D230.
    63. 63. Ng PC, Henikoff S (2003) SIFT: прогнозирование аминокислотных изменений, влияющих на функцию белка. Nucleic Acids Res 31: 3812–3814.
    64. 64. Ван К., Самудрала Р. (2006) Автоматическая функциональная классификация экспериментальных и прогнозируемых белковых структур. BMC Bioinformatics 7: 278.

    Аннотации функции белка с помощью вывода на основе гомологии | Геномная биология

  19. 1.

    Крыштафович А., Фиделис К., Моулт Дж .: Переход от CASP6 к CASP7. Белки. 2007, 69 (Дополнение 8): 194-207. 10.1002 / prot.21769.

    PubMed CAS Статья Google ученый

  20. 2.

    Grabowski M, Joachimiak A, Otwinowski Z, Minor W: Структурная геномика: не отставая от расширяющихся знаний о белковой вселенной. Curr Opin Struct Biol. 2007, 17: 347-353. 10.1016 / j.sbi.2007.06.003.

    PubMed CAS PubMed Central Статья Google ученый

  21. 3.

    Ривз Г.А., Торнтон Дж. М.: Интеграция биологических данных через геном. Hum Mol Genet. 2006, 15 (Спец №1): Р81-Р87. 10.1093 / hmg / ddl086.

    PubMed CAS Статья Google ученый

  22. 4.

    Прлик А., Даун Т.А., Кулеша Э., Финн Р.Д., Кахари А., Хаббард Т.Дж .: Интеграция последовательностей и структурной биологии с DAS. BMC Bioinformatics. 2007, 8: 333-10.1186 / 1471-2105-8-333.

    PubMed PubMed Central Статья Google ученый

  23. 5.

    Трамонтано A: Роль молекулярного моделирования в биомедицинских исследованиях. FEBS Lett. 2006, 580: 2928-2934. 10.1016 / j.febslet.2006.04.011.

    PubMed CAS Статья Google ученый

  24. 6.

    Эшбернер М., Болл К.А., Блейк Дж. А., Ботштейн Д., Батлер Х., Черри Дж. М., Дэвис А. П., Долински К., Дуайт С. С., Эппиг Д. Т., Харрис М. А., Хилл Д. П., Иссель-Тарвер Л., Касарскис А., Льюис С., Матезе Дж. К., Ричардсон Дж. Э., Рингуолд М., Рубин Г. М., Шерлок Дж. Онтология генов: инструмент для объединения биологии.Консорциум генных онтологий. Нат Жене. 2000, 25: 25-29. 10.1038 / 75556.

    PubMed CAS PubMed Central Статья Google ученый

  25. 7.

    Тресс М., Ченг Дж., Балди П., Джу К., Ли Дж., Со Дж. Х., Ли Дж., Бейкер Д., Чивиан Д., Ким Д., Эзкурдиа I. Оценка прогнозов, представленных для категории прогнозирования домена CASP7. Белки. 2007, 69 (Дополнение 8): 137-151. 10.1002 / prot.21675.

    PubMed CAS Статья Google ученый

  26. 8.

    Альтшул С.Ф., Гиш В., Миллер В., Майерс Е. В., Липман Д. Д.: Базовый инструмент поиска локального совмещения. J Mol Biol. 1990, 215: 403-410.

    PubMed CAS Статья Google ученый

  27. 9.

    Альтшул С.Ф., Мэдден Т.Л., Шеффер А.А., Чжан Дж., Чжан З., Миллер В., Липман Д.Д.: Gapped BLAST и PSI-BLAST: новое поколение программ поиска в базе данных белков. Nucleic Acids Res. 1997, 25: 3389-3402. 10.1093 / nar / 25.17.3389.

    PubMed CAS PubMed Central Статья Google ученый

  28. 10.

    Wu CH, Nikolskaya A, Huang H, Yeh LS, Natale DA, Vinayaka CR, Hu ZZ, Mazumder R, Kumar S, Kourtesis P, Ledley RS, Suzek BE, Arminski L, Chen Y, Zhang J, Cardenas JL, Chung S, Кастро-Альвеар Дж., Динков Г., Баркер В.К.: PIRSF: система классификации семейств в Информационном ресурсе белков. Nucleic Acids Res. 2004, Д112-Д114. 10.1093 / нар / гх097. 32 База данных

  29. 11.

    Reid AJ, Yeats C, Orengo CA: Методы удаленного определения гомологии могут быть объединены для увеличения охвата на 10% в полуночной зоне.Биоинформатика. 2007, 23: 2353-2360. 10.1093 / биоинформатика / btm355.

    PubMed CAS Статья Google ученый

  30. 12.

    Apic G, Gough J, Teichmann SA: Комбинации доменов в протеомах архей, эубактерий и эукариот. J Mol Biol. 2001, 310: 311-325. 10.1006 / jmbi.2001.4776.

    PubMed CAS Статья Google ученый

  31. 13.

    Марчлер-Бауэр А., Андерсон Дж. Б., Дербишир М.К., ДеВиз-Скотт К., Гонсалес Н.Р., Гвадз М., Хао Л., Хе С., Гурвиц Д.И., Джексон Д.Д., Ке З., Крылов Д., Ланчицкий К.Дж., Либерт CA, Лю С., Лу Ф., Лу С., Марчлер Г. Х., Муллокандов М., Сонг Дж. С., Танки Н., Ямасита Р. А., Инь Дж. Дж., Чжан Д., Брайант С.Х .: CDD: база данных сохраненных доменов для интерактивного анализа семейства доменов.Nucleic Acids Res. 2007, D237-D240. 10.1093 / нар / gkl951. 35 База данных

  32. 14.

    Хуло Н., Байрох А., Буллиард В., Серутти Л., Куш Б. А., де Кастро Е., Лашейз С., Лангендейк-Женево П.С., Сигрист К.Дж.: 20 лет ПРОЗИТЕ. Nucleic Acids Res. 2008, Д245-Д249. 36 База данных

  33. 15.

    Finn RD, Tate J, Mistry J, Coggill PC, Sammut SJ, Hotz HR, Ceric G, Forslund K, Eddy SR, Sonnhammer EL, Bateman A: База данных семейств белков Pfam. Nucleic Acids Res. 2008, D281-D288.36 База данных

  34. 16.

    Летуник I, Копли Р.Р., Пилс Б., Пинкерт С., Шульц Дж., Борк П.: SMART 5: домены в контексте геномов и сетей. Nucleic Acids Res. 2006, D257-D260. 10.1093 / нар / gkj079. 34 База данных

  35. 17.

    Универсальный белковый ресурс (UniProt). Nucleic Acids Res. 2008, D190-D195. 36 База данных

  36. 18.

    Малдер Н.Дж., Апвейлер Р., Эттвуд Т.К., Байроч А., Бейтман А., Биннс Д., Борк П., Бильярд В., Серутти Л., Копли Р., Курсель Е., Дас Ю., Догерти Л., Дибли М., Финн Р., Флейшманн В., Гоф Дж., Хафт Д., Хуло Н., Хантер С., Кан Д., Канапин А., Кеджаривал А., Лабарга А., Лангендейк-Женево П. С., Лонсдейл Д., Лопес Р., Летуник И., Мадера М., Маслен Дж., и др.: Новые разработки в базе данных InterPro.Nucleic Acids Res. 2007, D224-D228. 10.1093 / нар / gkl841. 35 База данных

  37. 19.

    Йейтс К., Лис Дж., Рид А., Келлам П., Мартин Н., Лю X, Оренго К.: Gene3D: всеобъемлющая структурная и функциональная аннотация геномов. Nucleic Acids Res. 2008, D414-D418. 36 База данных

  38. 20.

    Уилсон Д., Мадера М., Фогель С., Чотия С., Гоф Дж.: База данных SUPERFAMILY в 2007 году: семейства и функции. Nucleic Acids Res. 2007, D308-D313. 10.1093 / нар / gkl910. 35 База данных

  39. 21.

    Orengo CA, Michie AD, Jones S, Jones DT, Swindells MB, Thornton JM: CATH — иерархическая классификация структур белковых доменов. Состав. 1997, 5: 1093-1108. 10.1016 / S0969-2126 (97) 00260-8.

    PubMed CAS Статья Google ученый

  40. 22.

    Мурзин А.Г., Бреннер С.Е., Хаббард Т., Чотиа С: SCOP: структурная классификация базы данных белков для исследования последовательностей и структур. J Mol Biol. 1995, 247: 536-540.10.1006 / jmbi.1995.0159.

    PubMed CAS Google ученый

  41. 23.

    Татусов Р.Л., Федорова Н.Д., Джексон Д.Д., Якобс А.Р., Кирютин Б., Кунин Е.В., Крылов Д.М., Мазумдер Р., Мехедов С.Л., Никольская А.Н., Рао Б.С., Смирнов С., Свердлов А.В., Васудеван С., Вольф Ю.И. , Yin JJ, Natale DA: База данных COG: обновленная версия включает эукариоты. BMC Bioinformatics. 2003, 4: 41-10.1186 / 1471-2105-4-41.

    PubMed PubMed Central Статья Google ученый

  42. 24.

    Каплан Н., Сассон О., Инбар Ю., Фридлих М., Фромер М., Флейшер Н., Португалия Е., Линиал Н., Линия М.: ProtoNet 4.0: иерархическая классификация одного миллиона белковых последовательностей. Nucleic Acids Res. 2005, D216-D218. 33 База данных

  43. 25.

    Petryszak R, Kretschmann E, Wieser D, Apweiler R: Прогностическая сила базы данных CluSTr. Биоинформатика. 2005, 21: 3604-3609. 10.1093 / биоинформатика / bti542.

    PubMed CAS Статья Google ученый

  44. 26.

    Krause A, Stoye J, Vingron M: крупномасштабная иерархическая кластеризация белковых последовательностей. BMC Bioinformatics. 2005, 6: 15-10.1186 / 1471-2105-6-15.

    PubMed PubMed Central Статья Google ученый

  45. 27.

    Bru C, Courcelle E, Carrere S, Beausse Y, Dalmar S, Kahn D: База данных ProDom по семействам белковых доменов: больше внимания уделяется 3D. Nucleic Acids Res. 2005, D212-D215. 33 База данных

  46. 28.

    Portugaly E, Linial N, Linial M: EVEREST: коллекция эволюционно консервативных белковых доменов.Nucleic Acids Res. 2007, Д241-Д246. 10.1093 / нар / gkl850. 35 База данных

  47. 29.

    Watson JD, Sanderson S, Ezersky A, Savchenko A, Edwards A, Orengo C, Joachimiak A, Laskowski RA, Thornton JM: На пути к полностью автоматизированному предсказанию структурных функций в структурной геномике: тематическое исследование . J Mol Biol. 2007, 367: 1511-1522. 10.1016 / j.jmb.2007.01.063.

    PubMed CAS PubMed Central Статья Google ученый

  48. 30.

    Chothia C, Lesk AM: Связь между расхождением последовательности и структуры в белках. EMBO J. 1986, 5: 823-826.

    PubMed CAS PubMed Central Google ученый

  49. 31.

    Тейлор WR, Оренго, Калифорния: Выравнивание структуры белков. J Mol Biol. 1989, 208: 1-22. 10.1016 / 0022-2836 (89) -3.

    PubMed CAS Статья Google ученый

  50. 32.

    Redfern OC, Harrison A, Dallman T, Pearl FM, Orengo CA: CATHEDRAL: быстрый и эффективный алгоритм для прогнозирования складок и границ доменов на основе многодоменных белковых структур.PLoS Comput Biol. 2007, 3: e232-10.1371 / journal.pcbi.0030232.

    PubMed PubMed Central Статья Google ученый

  51. 33.

    Holm L, Sander C: Сравнение структуры белков путем выравнивания матриц расстояний. J Mol Biol. 1993, 233: 123-138. 10.1006 / jmbi.1993.1489.

    PubMed CAS Статья Google ученый

  52. 34.

    Криссинель Э., Хенрик К.: Сопоставление вторичных структур (SSM), новый инструмент для быстрого выравнивания структуры белка в трех измерениях.Acta Crystallogr D Biol Crystallogr. 2004, 60: 2256-2268. 10.1107 / S0

    4

  53. 6460.

    PubMed CAS Статья Google ученый

  54. 35.

    Мадей Т., Гибрат Дж. Ф., Брайант Ш. Распределение базы данных ядер белков. Белки. 1995, 23: 356-369. 10.1002 / prot.340230309.

    PubMed CAS Статья Google ученый

  55. 36.

    Шиндялов И.Н., Борн П.Е. Выравнивание структуры белка путем инкрементного комбинаторного удлинения (CE) оптимального пути.Protein Eng. 1998, 11: 739-747. 10.1093 / белок / 11.9.739.

    PubMed CAS Статья Google ученый

  56. 37.

    Колодный Р., Кель П., Левитт М.: Комплексная оценка методов выравнивания структуры белков: оценка по геометрическим критериям. J Mol Biol. 2005, 346: 1173-1188. 10.1016 / j.jmb.2004.12.032.

    PubMed CAS PubMed Central Статья Google ученый

  57. 38.

    Ye Y, Годзик A: Гибкое выравнивание структуры путем объединения пар выровненных фрагментов, допускающих скручивание. Биоинформатика. 2003, 19 (Приложение 2): ii246-255.

    PubMed Статья Google ученый

  58. 39.

    Берман Х.М., Вестбрук Дж., Фенг З., Гиллиланд Дж., Бхат Т.Н., Вайссиг Х., Шиндялов И.Н., Борн П.Е .: Банк данных по белкам. Nucleic Acids Res. 2000, 28: 235-242. 10.1093 / nar / 28.1.235.

    PubMed CAS PubMed Central Статья Google ученый

  59. 40.

    Polacco BJ, Babbitt PC: Автоматическое обнаружение трехмерных мотивов для аннотации функций белков. Биоинформатика. 2006, 22: 723-730. 10.1093 / биоинформатика / btk038.

    PubMed CAS Статья Google ученый

  60. 41.

    Kleywegt GJ: Распознавание пространственных мотивов в белковых структурах. J Mol Biol. 1999, 285: 1887-1897. 10.1006 / jmbi.1998.2393.

    PubMed CAS Статья Google ученый

  61. 42.

    Wangikar PP, Tendulkar AV, Ramya S, Mali DN, Sarawagi S: Функциональные сайты в семействах белков, обнаруженные с помощью объективного автоматизированного теоретико-графического подхода. J Mol Biol. 2003, 326: 955-978. 10.1016 / S0022-2836 (02) 01384-0.

    PubMed CAS Статья Google ученый

  62. 43.

    Laskowski RA, Luscombe NM, Swindells MB, Thornton JM: Белковые расщелины в молекулярном распознавании и функции. Protein Sci. 1996, 5: 2438-2452.

    PubMed CAS PubMed Central Google ученый

  63. 44.

    Ласковски Р.А.: SURFNET: программа для визуализации молекулярных поверхностей, полостей и межмолекулярных взаимодействий. J Mol Graph. 1995, 13: 323-330. 10.1016 / 0263-7855 (95) 00073-9.

    PubMed CAS Статья Google ученый

  64. 45.

    Ландау М., Мейроуз И., Розенберг Ю., Глэзер Ф, Мартц Э., Пупко Т., Бен-Тал Н.: ConSurf 2005: проекция эволюционных оценок сохранения остатков на белковых структурах.Nucleic Acids Res. 2005, 33: W299-W302. 10.1093 / нар / gki370.

    PubMed CAS PubMed Central Статья Google ученый

  65. 46.

    Глейзер Ф., Розенберг Ю., Кессель А., Пупко Т., Бен-Тал Н.: База данных ConSurf-HSSP: отображение эволюционной консервации среди гомологов на структуры PDB. Белки. 2005, 58: 610-617. 10.1002 / prot.20305.

    PubMed CAS Статья Google ученый

  66. 47.

    Бинковски Т.А., Фриман П., Лян Дж.: PvSOAR: обнаружение сходных структур поверхностей карманов и пустот аминокислотных остатков на белках. Nucleic Acids Res. 2004, 32: W555-W558. 10.1093 / нар / гх490.

    PubMed CAS PubMed Central Статья Google ученый

  67. 48.

    Dundas J, Ouyang Z, Tseng J, Binkowski A, Turpaz Y, Liang J: CASTp: вычисленный атлас топографии поверхности белков со структурным и топографическим картированием функционально аннотированных остатков.Nucleic Acids Res. 2006, 34: W116-W118. 10.1093 / нар / gkl282.

    PubMed CAS PubMed Central Статья Google ученый

  68. 49.

    Бэгли С.К., Альтман Р.Б .: Характеристика микросреды, окружающей белковые участки. Protein Sci. 1995, 4: 622-635.

    PubMed CAS PubMed Central Статья Google ученый

  69. 50.

    Шульман-Пелег А., Нусинов Р., Вольфсон HJ: SiteEngines: распознавание и сравнение сайтов связывания и межбелковых интерфейсов.Nucleic Acids Res. 2005, 33: W337-W341. 10.1093 / нар / gki482.

    PubMed CAS PubMed Central Статья Google ученый

  70. 51.

    Сасин Дж. М., Годзик А., Буйницки Дж. М.: СЕРФ-ВЕРХ! — классификация белков путем сравнения поверхностей. J Biosci. 2007, 32: 97-100. 10.1007 / s12038-007-0009-0.

    PubMed CAS Статья Google ученый

  71. 52.

    Porter CT, Bartlett GJ, Thornton JM: The Catalytic Site Atlas: ресурс каталитических сайтов и остатков, идентифицированных в ферментах с использованием структурных данных.Nucleic Acids Res. 2004, 32: D129-D133. 10.1093 / нар / гх028.

    PubMed CAS PubMed Central Статья Google ученый

  72. 53.

    Иванисенко В.А., Пинтус С.С., Григорович Д.А., Колчанов Н.А.: PDBSiteScan: программа для поиска сайтов активных, связывающих и посттрансляционных модификаций в трехмерных структурах белков. Nucleic Acids Res. 2004, 32: W549-W554. 10.1093 / нар / гх539.

    PubMed CAS PubMed Central Статья Google ученый

  73. 54.

    Иванисенко В.А., Пинтус С.С., Григорович Д.А., Колчанов Н.А.: PDBSite: база данных трехмерной структуры функциональных сайтов белков. Nucleic Acids Res. 2005, 33: D183-D187. 10.1093 / нар / gki105.

    PubMed CAS PubMed Central Статья Google ученый

  74. 55.

    Джордж Р.А., Сприггс Р.В., Бартлетт Г.Дж., Гаттеридж А., Макартур М.В., Портер К.Т., Аль-Лазикани Б., Торнтон Дж. М., Суинделлс М.Б .: Эффективная аннотация функции посредством сохранения каталитического остатка.Proc Natl Acad Sci USA. 2005, 102: 12299-12304. 10.1073 / pnas.0504833102.

    PubMed CAS PubMed Central Статья Google ученый

  75. 56.

    Ласковски Р.А., Уотсон Дж. Д., Торнтон Дж. М.: ProFunc: сервер для прогнозирования функции белка по трехмерной структуре. Nucleic Acids Res. 2005, 33: W89-W93. 10.1093 / нар / gki414.

    PubMed CAS PubMed Central Статья Google ученый

  76. 57.

    Темпура. [http://www.ebi.ac.uk/thornton-srv/databases/tempura]

  77. 58.

    Старк А., Рассел РБ: Аннотация в трех измерениях. PINTS: паттерны в негомологичных третичных структурах. Nucleic Acids Res. 2003, 31: 3341-3344. 10.1093 / нар / гкг506.

    PubMed CAS PubMed Central Статья Google ученый

  78. 59.

    Lichtarge O, Bourne HR, Cohen FE: Метод эволюционного отслеживания определяет поверхности связывания, общие для семейств белков.J Mol Biol. 1996, 257: 342-358. 10.1006 / jmbi.1996.0167.

    PubMed CAS Статья Google ученый

  79. 60.

    Кристенсен Д.М., Уорд Р.М., Лисевски А.М., Эрдин С., Чен Б.Ю., Фофанов В.Ю., Киммел М., Кавраки Л.Е., Лихтарге О: Прогнозирование функции ферментов на основе трехмерных матриц эволюционно важных аминокислот. BMC Bioinformatics. 2008, 9: 17-10.1186 / 1471-2105-9-17.

    PubMed PubMed Central Статья Google ученый

  80. 61.

    Уорд Р.М., Эрдин С., Тран Т.А., Кристенсен Д.М., Лисевски А.М., Лихтардж О.: Деорфанизация структурного протеома посредством взаимного сравнения эволюционно важных структурных особенностей. PLoS ONE. 2008, 3: e2136-10.1371 / journal.pone.0002136.

    PubMed PubMed Central Статья Google ученый

  81. 62.

    Herrgard S, Cammer SA, Hoffman BT, Knutson S, Gallina M, Speir JA, Fetrow JS, Baxter SM: Прогнозирование вредных функциональных эффектов аминокислотных мутаций с использованием библиотеки дескрипторов функций на основе структуры.Белки. 2003, 53: 806-816. 10.1002 / prot.10458.

    PubMed CAS Статья Google ученый

  82. 63.

    Пал Д., Айзенберг Д.: Вывод о функции белка на основе структуры белка. Состав. 2005, 13: 121-130. 10.1016 / j.str.2004.10.015.

    PubMed CAS Статья Google ученый

  83. 64.

    Салвински Л., Миллер С.С., Смит А.Дж., Петтит Ф.К., Боуи Ю.Ю., Эйзенберг Д.: База данных взаимодействующих белков: обновление 2004 г.Nucleic Acids Res. 2004, 32: D449-D451. 10.1093 / нар / gkh086.

    PubMed CAS PubMed Central Статья Google ученый

  84. 65.

    Фридберг И., Хардер Т., Годзик A: JAFA: мета-сервер аннотации функций белка. Nucleic Acids Res. 2006, 34: W379-W381. 10.1093 / nar / gkl045.

    PubMed CAS PubMed Central Статья Google ученый

  85. 66.

    фон Меринг С., Краузе Р., Снел Б., Корнелл М., Оливер С.Г., Филдс С., Борк П.: Сравнительная оценка крупномасштабных наборов данных белок-белковых взаимодействий.Природа. 2002, 417: 399-403. 10.1038 / природа750.

    PubMed CAS Статья Google ученый

  86. 67.

    Pagel P, Kovac S, Oesterheld M, Brauner B, Dunger-Kaltenbach I, Frishman G, Montrone C, Mark P, Stümpflen V, Mewes HW, Ruepp A, Frishman D: белок-белок млекопитающих MIPS база данных взаимодействия. Биоинформатика. 2005, 21: 832-834. 10.1093 / биоинформатика / bti115.

    PubMed CAS Статья Google ученый

  87. 68.

    Харт Г.Т., Рамани А.К., Маркотт Е.М.: Насколько полны существующие сети взаимодействия дрожжей и белков человека ?. Genome Biol. 2006, 7: 120-10.1186 / GB-2006-7-11-120.

    PubMed PubMed Central Статья Google ученый

  88. 69.

    Элой П., Рассел РБ: Десять тысяч взаимодействий для молекулярного биолога. Nat Biotechnol. 2004, 22: 1317-1321. 10.1038 / nbt1018.

    PubMed CAS Статья Google ученый

  89. 70.

    Finn RD, Marshall M, Bateman A: iPfam: визуализация белок-белковых взаимодействий в PDB при разрешении домена и аминокислот. Биоинформатика. 2005, 21: 410-412. 10.1093 / биоинформатика / bti011.

    PubMed CAS Статья Google ученый

  90. 71.

    Stein A, Russell RB, Aloy P: 3did: взаимодействующие белковые домены известной трехмерной структуры. Nucleic Acids Res. 2005, 33: D413-D417. 10.1093 / нар / gki037.

    PubMed CAS PubMed Central Статья Google ученый

  91. 72.

    Riley R, Lee C, Sabatti C, Eisenberg D: Выведение взаимодействий белковых доменов из баз данных взаимодействующих белков. Genome Biol. 2005, 6: R89-10.1186 / gb-2005-6-10-r89.

    PubMed PubMed Central Статья Google ученый

  92. 73.

    Jothi R, Cherukuri PF, Tasneem A, Przytycka TM: Коэволюционный анализ доменов во взаимодействующих белках раскрывает понимание доменных взаимодействий, опосредующих межбелковые взаимодействия.J Mol Biol. 2006, 362: 861-875. 10.1016 / j.jmb.2006.07.072.

    PubMed CAS PubMed Central Статья Google ученый

  93. 74.

    Пагель П., Вонг П., Фришман Д.: Карта взаимодействия доменов, основанная на филогенетическом профилировании. J Mol Biol. 2004, 344: 1331-1346. 10.1016 / j.jmb.2004.10.019.

    PubMed CAS Статья Google ученый

  94. 75.

    Пагель П., Эстерхельд М., Товстухина О., Страк Н., Стампфлен В., Фришман Д.: DIMA 2.0 — предполагаемые и известные доменные взаимодействия. Nucleic Acids Res. 2008, D651-D655. 36 База данных

  95. 76.

    Raghavachari B, Tasneem A, Przytycka TM, Jothi R: DOMINE: база данных взаимодействий белковых доменов. Nucleic Acids Res. 2008, D656-D661. 36 База данных

  96. 77.

    Моулт Дж., Педерсен Дж. Т., Джадсон Р., Фиделис К.: крупномасштабный эксперимент по оценке методов прогнозирования структуры белка. Белки. 1995, 23: ii-v. 10.1002 / prot.340230303.

    PubMed CAS Статья Google ученый

  97. 78.

    Соро С., Трамонтано А. Прогнозирование функции белка в CASP6. Белки. 2005, 61 (Приложение 7): 201-213. 10.1002 / prot.20738.

    PubMed CAS Статья Google ученый

  98. 79.

    Пеллегрини-Калаче М., Соро С., Трамонтано А: Пересмотр предсказания функции белка в CASP6. FEBS J. 2006, 273: 2977-2983. 10.1111 / j.1742-4658.2006.05309.x.

    PubMed CAS Статья Google ученый

  99. 80.

    AFP. [http://biofunctionprediction.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *