Белки кратко и понятно: Строение и функции белков — конспект

Содержание

Строение и функции белков — конспект

  
Вернуться к теме «Строение и функции белков»

Белки – полимеры, мономерами которых являются аминокислоты.

Среди органических веществ белки занимают первое место по количеству и по значению. В организме человека встречаются 5 млн разнообразных белковых молекул, отличающихся не только друг от друга, но и от белков других организмов. Несмотря на такое разнообразие и сложность строения они построены всего из 20 различных аминокислот.

Строение аминокислоты:

 

В левой части молекулы расположены группа h3N–, которая обладает свойствами основания; справа — группа –COOH — кислотная, характерная для всех органических кислот. Следовательно, аминокислоты – амфотерные соединения, совмещающие свойства и кислоты и основания. Этим обусловлена их способность взаимодействовать друг с другом.

Соединяясь, молекулы аминокислот образуют связи между углеродом кислотной и азотом основной групп. Такие связи называются ковалентными, а в данном случае – пептидными связями:

Соединение двух аминокислот в одну молекулу называется дипептидом, трех аминокислот – трипептидом и т. д., а соединение, состоящее из 20 и более аминокислотных остатков, – полипептидом.

Последовательность аминокислот в полипептидной цепи принято называть первичной структурой белка.

Однако молекула белка в виде цепи аминокислотных остатков, последовательно соединенных между собой пептидными связями, еще не способна выполнять специфические функции. Для этого необходима более высокая структурная организация. Путем образования водородных связей между остатками карбоксильных и аминогрупп разных аминокислот белковая молекула принимает вид спирали (α-структура) или складчатого слоя – «гармошки» (β-структура). Это

вторичная структура белка. Но и ее часто недостаточно для приобретения характерной биологической активности.

Часто только молекула, обладающая третичной структурой, может выполнять роль катализатора или любую другую. Третичная структура образуется благодаря взаимодействию радикалов, в частности радикалов аминокислоты цистеина, которые содержат серу. Атомы серы двух аминокислот, находящихся на некотором расстоянии друг от друга в полипептидной цепи, соединяются, образуя так называемые дисульфидные, или S–S, связи. Благодаря этим взаимодействиям, а также другим, менее сильным связям, белковая спираль сворачивается и приобретает форму шарика, или глобулы. Способ укладки полипептидных спиралей в глобуле называют третичной структурой белка. Многие белки, обладающие третичной структурой, могут выполнять свою биологическую роль в клетке. Однако для осуществления некоторых функций организма требуется участие белков с еще более высоким уровнем организации.

Такую организацию называют четвертичной структурой. Присутствует не у всех белков. Она представляет собой функциональное объединение нескольких (двух, трех и более) молекул белка, обладающих третичной структурной организацией. Пример такого сложного белка – гемоглобин. Его молекула состоит из четырех связанных между собой молекул. Другим примером может служить гормон поджелудочной железы – инсулин, включающий два компонента. В состав четвертичной структуры некоторых белков включаются помимо белковых субъединиц и разнообразные небелковые компоненты. Тот же гемоглобин содержит сложное гетероциклическое соединение, в состав которого входит железо.

Строение белковой молекулы: А – первичная; Б – вторичная; В – третичная; Г – четвертичная структура

Строение молекулы гемоглобина

Гемоглобин – белок четвертичной структуры. В молекуле гемоглобина белковый компонент представлен белком глобином, небелковый компонент – гем. Глобин состоит из 4 субъединиц. Внутри каждой субъединицы имеется гидрофобный «карман», в котором располагается гем. Содержащийся в геме атом железа связывает кислород.

Свойства белка

Белки, как и другие неорганические и органические соединения, обладают рядом физико-химических свойств:

  1. Белки – преимущественно водорастворимые молекулы и, следовательно, могут проявлять свою функциональную активность только в водных растворах.
  2. Белковые молекулы несут большой поверхностный заряд. Это определяет целый ряд электрохимических эффектов, например изменение проницаемости мембран каталитической активности и других функций.
  3. Белки термолабильны, то есть проявляют свою активность в узких температурных рамках.

Денатурация и ренатурация белков

Денатурация  – это утрата белковой молекулой своей структурной организации: четвертичной, третичной, вторичной, а при более жестких условиях – и первичной структуры. В результате денатурации белок теряет способность выполнять свою функцию.

Причинами денатурации могут быть высокая температура, ультрафиолетовое излучение, действие сильных кислот и щелочей, тяжелых металлов и органических растворителей. Если изменение условий среды не приводит к разрушению первичной структуры молекулы, то при восстановлении нормальных условий среды полностью воссоздается структура белка и его функциональная активность. Такой процесс носит название ренатурации.

Функции белков

1. Каталитическая (ферментативная) функция:

Многие белки являются ферментами. Ферменты — это биологические катализаторы, т. е. вещества, ускоряющие протекание химических реакций в живых организмах. Ферменты участвуют в процессах синтеза и расщепления различных веществ. Они обеспечивают фиксацию углерода в процессе фотосинтеза, расщепление питательных веществ в пищеварительном тракте и т. д. 

 

2. Транспортная функция

Многие белки способны присоединять и переносить различные вещества. Гемоглобин связывает и переносит кислород и углекислый газ. Альбумины крови транспортируют жирные кислоты, глобулины — ионы металлов и гормоны. Многие белки, входящие в состав цитоплазматической мембраны, участвуют в транспорте веществ в клетку и из нее.

3. Защитная функция

Белки предохраняют организм от вторжения чужеродных организмов и от повреждений. Так, в ответ на проникновение чужеродных объектов (антигенов) определенные лейкоциты вырабатывают специфические белки — иммуноглобулины (антитела), участвующие в иммунном ответе организма. Белок плазмы крови фибриноген, участвуя в свертывании крови и тем самым уменьшая кровопотери.

4. Двигательная (сократительная) функция

Сократительные белки обеспечивают способность клеток, тканей, органов и целых организмов изменять форму, двигаться. Так, актин и миозин обеспечивают работу мышц и немышечные внутриклеточные сокращения.

5. Структурная (строительная, пластическая) функция

Белки входят в состав всех клеток и тканей живых организмов. Белки являются обязательным компонентом всех клеточных мембран и органоидов клетки. Из белков построены элементы цитоскелета, сократительные элементы мышечных волокон. Преимущественно из белков состоят хрящи и сухожилия. В их состав входит белок коллаген. Важнейшим структурным компонентом перьев, волос, ногтей, когтей, рогов, копыт у животных является белок кератин. В состав связок, стенок артерий и лёгких входит структурный белок эластин.

6. Сигнальная (рецепторная) функция

Некоторые белки клеточных мембран способны изменять свою структуру в ответ на действие внешних факторов. С помощью этих белков происходит прием сигналов из внешней среды и передача информации в клетку.

7. Регуляторная функция

Некоторые белки являются гормонами. Они влияют на различные физиологические процессы. Например, инсулин и глюкагон регулируют содержание глюкозы в крови, а соматотропин (гормон роста) — процессы роста и физического развития.

8. Запасающая (питательная) функция

В семенах растений запасаются резервные белки, которые используются при прорастании зародышем.

9. Энергетическая функция

При полном окислении 1 г белка выделяется 17,6 кДж энергии. Однако белки расходуются на энергетические нужды лишь в крайних случаях, когда исчерпаны запасы углеводов и жиров.

введение для айтишников / Хабр

Приятно видеть, что хабравчане регулярно интересуется другими предметными областями – например, биологией (более конкретно – структурой и функцией биологических макромолекул). Однако некоторые посты (например,

этот

), вызывают у специалиста просто физическую боль из-за обилия совершенно диких фактологических ошибок. В этом посте мне хочется рассказать о структуре и функции белка. О том, что мы знаем и о том, чего не знаем, а так же об имеющихся в этой области вычислительных задачах, требующих решения и интересных IT-специалистам. Постараюсь рассказывать сжато и тезисно, чтобы информации было больше, а воды – меньше. Всех, интересующихся структурой белков, прошу под кат, там очень много букв.



1. Почему белки важны?

Как сказал Фридрих Энгельс, “Жизнь есть способ существования белковых тел”. В 19 веке еще не знали о роли ДНК в наследовании генетической информации, но утверждение дяди Фридриха в значительной мере справедливо до сих пор – основную работу в наших клетках совершают именно белки. Это и поддержание структуры (формы клеток), и химический катализ, и моторная функция (сокращение мышц, например), и транспорт (скажем, белок гемоглобин переносит кислород из легких в ткани и углекислый газ в обратном направлении) и сложные регуляторные функции по поддержанию постоянства внутренней среды (скажем, белковые гормоны и всякие внутриклеточные регуляторные системы) и многие другие. Словом, если в нашем организме что-то происходит, в это обязательно вовлечены белки (хотя и не только они).

2. Что такое белок?

С химической точки зрения белок – это линейный (неветвящийся) полимер, состоящий из монотонно повторяющихся одинаковых блоков «основной цепи», к которым приделаны различные «боковые группы». Так как блоки основной цепи несимметричны, вся полипептидная цепь белка имеет направление, различают N- и C-конец полипептидной цепи.


Длина цепи – от 70 до более чем 1000 мономеров (аминокислотных остатков), средняя длина для высших организмов – примерно 500-600 аминокислотных остатков, для бактерий эта величина будет меньше, скорее 300-400 остатков. Всего в природе существует 20 стандартных аминокислот, одинаковых и для бактерии и для человека, то есть из основной цепи могут торчать 20 разных боковых групп.


(Тут возможна поправка – некоторые химические группы могут быть модифицированны после синтеза белка, например, фосфорилированы. Однако это не рассматривается как другая аминокислота, а рассматривается как продукт модификации исходной. Так же у высших организмов возможно встраивание двух неканонических аминокислот, но это редкое событие. То есть, строго говоря, разных аминокислот 22, из них 20 основных и 2 редкие, плюс некоторые боковые группы могут быть изредка химически модифицированы).

Из поколения в поколение генетическая информация передается в виде ДНК, в ней есть так называемые «белок-кодирующие области». В этих местах ДНК однозначным образом (для ботанов – с точностью до альтернативного сплайсинга и редактирования РНК) закодирована информация о линейной последовательности аминокислот для синтеза данного белка, плюс в клетке есть соответствующие машины, способные синтезировать белок по информации, изначально закодированной в ДНК.

Так как белок – линейный полимер, собранный из 20 стандартных мономеров, его так называемую «первичную структуру» легко представить в виде строки, например так:

 
>small ubiquitin-related modifier 3 precursor [Homo sapiens]
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQG
LSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Это аминокислотная последовательность маленького человеческого белка в формате FASTA, первая строчка, начинающаяся с «>», описывает его название, после чего следует последовательность аминокислот в соответствии со стандартной кодировкой (например, М –метиони, S – серин и тд, всего 20 букв стандартного однобуквенного кода), слева – N-конец белка, справа – его С-конец. Для разных белков длина строки будет очевидно разной, так как белки имеют разную длину. Последовательности всех известных белков можно найти в открытом доступе здесь: www.ncbi.nlm.nih.gov

3. Структура белка

Хорошо, с первичной структурой разобрались, но разве белок работает в развернутом линейном виде? Конечно нет. Тут надо заметить, что со структурной точки зрения есть разные классы белков: глобулярные, мембранные и фибриллярные. Мембранные белки, как следует из названия, живут только в клеточных мембранах, для стабилизации их структуры нужно особое окружение мембраны, мы не будем их рассматривать в этом обзоре. Фибриллярные белки имеют простое регулярное строение, похожи на вытянутые волокна, они не растворимы в воде и выполняют структурные функции (например, из кератина состоят волосы, к фибриллярным белкам относится белок из натурального шёлка). Недавно стали выделять класс разупорядоченных белков – белков, не обладающих постоянной трехмерной структурой, либо приобретающих ее только на короткое время при взаимодействии с другими белками. Наиболее интересный с практической точки зрения класс белков, который мы и будем рассматривать – глобулярные водорастворимые белки, к этому классу относится большинство белков.

Линейная полипептидная цепь в воде способна самопроизвольно сворачиваться в сложную трехмерную структуру (глобулу) и только в таком свернутом виде белки могут выполнять химический катализ и прочую интересную работу. Поэтому нам принципиально важно знать именно трехмерную укладку белка, так как только на этом уровне становится понятно, как белок работает.

Вопрос: сколько трехмерных структур соответствует конкретному белку?
Ответ: Одна, с точностью до небольшой подвижности маленьких «разупорядоченных» петель. Известно ровно одно исключение, когда одной последовательности соответствуют 2 достаточно разные структуры, это прионы.

Вопрос: Почему у белка только одна трехмерная структура?
Ответ: для химического катализа нам нужно расположить соответствующие химические группы строго определенным образом в пространстве. Для этого нужна жесткая структура. То есть весь белок должен быть жестким, чтобы поддерживать химические группы аминокислот активного центра в нужных местах (в реальности многие белки состоят из двух и более жестких частей, которые могут двигаться друг относительно друга, это нужно для регуляции активности белка (аллостерическая регуляция), чтобы некий сигнал мог включать и выключать химическую активность белка-фермента). Чтобы структура была жесткой и стабильной, природа позаботилась о том, чтобы структура каждого белка соответствовала энергетическому минимуму данной системы атомов и этот минимум был настолько глубоким, чтобы белок из него не «выпрыгнул». Все другие, паразитные структуры, обладают большей энергией и белок все равно сваливается в энергетический минимум, соответствующий нативной структуре.

Вопрос: на чем держится трехмерная структура белка?
Ответ: если коротко, то в основном на большом количестве нековалентных взаимодействий. В принципе, химические группы белка могут образовывать: (1) водородную связь, эти группы есть и в основной цепи и у некоторых боковых групп, (2) ионную связь – электростатическое взаимодействие между разноименно заряженными боковыми группами, (3) Ван-дер-Ваальсово взаимодействие и (4) гидрофобный эффект, на котором держится общая структура белка. Суть в том, что в белке всегда есть гидрофобные ароматические остатки, им энергетически невыгодно контактировать с полярными молекулами воды, а выгодно «слипнуться» друг с другом. Таким образом, при сворачивании белка гидрофобные группы выталкиваются из водного окружения, «слипаясь» друг с другом и формируя «гидрофобное ядро», а полярные и заряженные группы, наоборот, стремятся в водное окружение, формируя поверхность белковой глобулы. Так же (5) боковые группы двух остатков цистеина могут образовать между собой дисульфидный мостик – полноценную ковалентную связь, жестко фиксирующую белок.

Соответственно, все аминокислоты делятся на гидрофобные, полярные (гидрофильные), положительно и отрицательно заряженные. Плюс цистеины, способные образовывать ковалентную связь между собой. Особыми свойствами обладают глицин – у него отсутствует боковая группа, сильно ограничивающая конформационную подвижность других остатков, поэтому он может очень сильно «гнуться» и находится в местах, где белковую цепь надо развернуть. У пролина же, наоборот, боковая группа образует кольцо, ковалентно связанное с основной цепью, жестко фиксируя ее конформацию. Пролины встречаются там, где надо сделать белковую цепь жесткой и негнущейся. Многие заболевания связаны с мутацией пролина на глицин, из-за чего структура белка слегка «плывет».

Вопрос: откуда вообще мы знаем о трехмерных структурах белка?
Ответ: из эксперимента, это абсолютно надежные данные.
Сейчас есть 3 метода для экспериментального определения структуры белка: ядерно-магнитный резонанс (ЯМР), cryo-EM (электронная микроскопия) и рентгеноструктурный анализ кристаллов белка.

ЯМР позволяет определить структуру белка в растворе, но он работает только для очень маленьких белков (для больших невозможно сделать деконволюцию).

Этот метод был важен для общего доказательства того, что у белка только одна трехмерная структура и что структура белка в кристалле идентична структуре в растворе. Это очень дорогой метод, так как требуется получить белок с изотопными метками.

Cryo-EM заключается в простой заморозке раствора белка и микроскопии. Минус метода – низкое разрешение (видна лишь общая форма молекулы, но не видно, как она устроена внутри), плюс плотность белка близка к плотности воды/растворителя, поэтому сигнал тонет в высоком уровне шума. В этом методе активно применяются компьютерные технологии работы с картинками и статистика для вытягивания сигнала из шума.

Отбираются миллионы картинок молекул белка, проводится разделение на классы в зависимости от ориентации молекулы относительно подложки, усреднение по классам, генерация eigenimages, новый раунд усреднения и так пока не сойдется. Потом из информации из разных классов можно восстановить трехмерный вид молекулы с низким разрешением. Если же есть внутренняя симметрия частиц (например, при cryo-EM анализе вирусов), то можно еще каждую частицу поусреднять в соответствии с операторами симметрии – тогда разрешение будет еще лучше, но хуже, чем в случае рентгеноструктурного анализа.

Рентгеноструктурный анализ – основной способ определения структур белка. Главный плюс – потенциально можно получить кристаллы даже очень больших комплексов из многих десятков белков (например, именно так была определена структура рибосомы – Нобелевская премия 2009 года). Минус метода – вначале нужно получить кристалл белка, но далеко не каждый белок хочет кристаллизоваться.

Зато после того, как кристалл получен, по дифракции рентгеновского излучения можно однозначно определить положения всех (упорядоченных) атомов в молекуле белка, этот метод дает самое высокое разрешение и позволяет в лучших случаях видеть позиции отдельных атомов. Было доказано, что структура белка в кристалле однозначно соответствует структуре в растворе.

Сейчас действует конвенция – если ты определил структуру белка любым из экспериментальных физических методов, структура должна быть помещена в открытый доступ в банк данных белковых структур (Protein Data Bank – PDB, www.pdb.org ), в настоящее время там находится более 90 000 структур (впрочем, многие из них повторяющиеся, например, комплексы одного и того же белка с разными малыми молекулами, такими, как лекарственные средства). В PDB все структуры лежат в стандартном формате, называющемся, внезапно, pdb. Это текстовый формат, в котором каждому атому структуры соответствует одна строчка, в которой указан номер атома в структуре, название атома (углерод, азот и тд), название аминокислоты, в которую входит атом, название цепи белка (A, B, C и тд, если это кристалл комплекса из нескольких белков), номер аминокислоты в цепи и трехмерные координаты атома в ангстремах относительно ориджина, плюс так называемые температурный фактор и заселённость (это сугубо кристаллографические параметры).

ATOM      1  N   HIS A  17     -12.690   8.753   5.446  1.00 29.32           N  
ATOM      2  CA  HIS A  17     -11.570   8.953   6.350  1.00 21.61           C  
ATOM      3  C   HIS A  17     -10.274   8.970   5.544  1.00 22.01           C  
ATOM      4  O   HIS A  17     -10.193   8.315   4.491  1.00 29.95           O  
ATOM      5  CB  HIS A  17     -11.462   7.820   7.380  1.00 23.64           C  
ATOM      6  CG  HIS A  17     -12. 551   7.811   8.421  1.00 21.18           C  
ATOM      7  ND1 HIS A  17     -13.731   7.137   8.194  1.00 28.94           N  
ATOM      8  CD2 HIS A  17     -12.634   8.384   9.644  1.00 21.69           C  
ATOM      9  CE1 HIS A  17     -14.492   7.301   9.267  1.00 27.01           C  
ATOM     10  NE2 HIS A  17     -13.869   8.058  10.168  1.00 22.66           N  
ATOM     11  N   ILE A  18      -9.269   9.660   6.089  1.00 19.45           N  
ATOM     12  CA  ILE A  18      -7.910   9.377   5.605  1.00 18.67           C  
ATOM     13  C   ILE A  18      -7.122   8.759   6.749  1.00 16.24           C  
ATOM     14  O   ILE A  18      -7.425   8.919   7.929  1.00 18.80           O  
ATOM     15  CB  ILE A  18      -7.228  10.640   5.088  1.00 20.22           C  
ATOM     16  CG1 ILE A  18      -7.062  11.686   6.183  1.00 18.52           C  
ATOM     17  CG2 ILE A  18      -7.981  11.176   3.889  1.00 24.61           C  
ATOM     18  CD1 ILE A  18      -6.161  12.824   5.749  1.00 28. 21           C  
ATOM     19  N   ASN A  19      -6.121   8.023   6.349  1.00 15.46           N  
ATOM     20  CA  ASN A  19      -5.239   7.306   7.243  1.00 14.34           C  
ATOM     21  C   ASN A  19      -4.012   8.178   7.507  1.00 14.83           C  
ATOM     22  O   ASN A  19      -3.431   8.715   6.575  1.00 18.03           O  
ATOM     23  CB  ASN A  19      -4.825   6.003   6.573  1.00 17.71           C  
ATOM     24  CG  ASN A  19      -6.062   5.099   6.413  1.00 21.26           C  
ATOM     25  OD1 ASN A  19      -6.606   4.651   7.400  1.00 26.18           O  
ATOM     26  ND2 ASN A  19      -6.320   4.899   5.151  1.00 31.73           N  

Далее есть специальные программы, которые по данным из этого текстового файла могут графически отображать красивую трехмерную структуру молекулы белка, которую можно покрутить на экране монитора и, как говорил Гай Додсон, «дотронуться мышкой до молекулы» (например, PyMol, CCP4mg, старый RasMol). То есть смотреть на структуры белка просто – ставишь программу, загружаешь нужную структуру из PDB и наслаждаешься красотой природы.

4. Анализируем структуру

Итак, мы поняли основную идею: белок — линейный полимер, сворачивающийся в водном растворе под действием множества слабых взаимодействий в стабильную и единственную для данного белка трехмерную структуру, и способный в таком виде выполнять свою функцию. Различают несколько уровней организации белковых структур. Выше мы уже познакомились с первичной структурой – линейной последовательностью аминокислот, которую можно выписать в строчку.


Вторичная структура белка определяется взаимодействием атомов основной цепи белка. Как уже было сказано выше, в состав основной цепи белка входят доноры и акцепторы водородной связи, таким образом, основная цепь может приобретать некоторую структуру. Точнее, несколько разных структур (детали все-таки зависят от различающихся боковых групп), так как возможно образование разных альтернативных водородных связей между группами основной цепи. Структуры бывают такие: альфа-спираль, бета-листы (состоящие из нескольких бета-тяжей), которые бывают параллельными и анти-параллельными, бета-поворот. Плюс часть цепи может и не иметь выраженной структуры, например в районе поворота петли белка. Эти типы структур имеют свои устоявшиеся схематичные обозначения – альфа-спираль в виде спирали или цилиндра, бета-тяжи в виде широких стрелок. Вторичную структуру удается достаточно достоверно предсказывать по первичной (стандартом является JPred), альфа-спирали предсказываются наиболее точно, с бета-тяжами бывают накладки.

Третичная структура белка определяется взаимодействием боковых групп аминокислотных остатков, это и есть трехмерная структура белка. Можно представить себе, что вторичная структура сформирована и теперь эти спирали и бета-тяжи хотят уложиться все вместе в компактную трехмерную структуру, чтобы все гидрофобные боковые группы спокойно «слиплись» вместе в глубине белковой глобулы, сформировав гидрофобное ядро, а полярные и заряженные остатки торчали наружу в воду, формируя поверхность белка и стабилизируя контакты между элементами вторичной структуры. Третичную структуру изображают схематически несколькими способами. Если просто отрисовать все атомы, то получится каша (хотя когда мы анализируем активный центр белка, то мы хотим смотреть как раз на все атомы активных остатков).

Если мы хотим посмотреть, как устроен весь белок в общем, можно отобразить только некоторые атомы основной цепи, чтобы увидеть ее ход. Как вариант, можно нарисовать красивую схему, где поверх реального расположения атомов схематично нарисованы элементы вторичной структуры – так с первого взгляда видна укладка белка. После изучения всей структуры в общем, схематичном виде, можно отобразить химические группы активного центра и уже сосредоточиться на них. Задача предсказания третичной структуры белка – нетривиальная и в общем случае не решается, хотя может быть решена в частных случаях. Подробнее – ниже.

Четвертичная структура белка – да, есть и такая, правда не у всех белков. Многие белки работают сами по себе (мономеры, в данном случае под мономером имеется в виду одиночная свернутая полипептидная цепь, то есть белок целиком), тогда их четвертичная структура равна третичной. Однако достаточно много белков работает только в комплексе, состоящем из нескольких полипептидных цепей (субъединиц или мономеров — димеры, тримеры, тетрамеры, мультимеры), тогда вот такая сборка из нескольких отдельных цепей и называется четвертичной структурой. Самый банальный пример – состоящий из 4 субъединиц гемоглобин, самый красивый на мой взгляд пример – состоящий из 11 одинаковых субъединиц бактериальный белок TRAP.

5. Вычислительные задачи

Белок – сложная система из тысяч атомов, поэтому без использования компьютеров в структуре белка не разобраться. Задач, как решенных на приемлемом уровне, так и совсем не решенных, множество. Перечислю наиболее актуальные:

На уровне первичной структуры – поиск белков с похожей аминокислотной последовательностью, построение по ним эволюционных деревьев и тд – классические задачи биоинформатики. Главным хабом является NCBI — The National Center for Biotechnology Information, www.ncbi.nlm.nih.gov. Для поиска белков со сходной последовательностью стандартно используется BLAST: blast. ncbi.nlm.nih.gov/Blast.cgi

Предсказание растворимости белка. Речь идет о том, что если мы прочитаем геном какого-нибудь животного, определим по нему последовательности белков, переклонируем эти гены в кишечную палочку или baculovirus expression system, то окажется, что при экспрессии в этих системах примерно треть белков не будет сворачиваться в правильную структуру, и, как следствие, будет нерастворима. Тут выясняется, что большие белки на самом деле состоят из отдельных «доменов», каждый из которых представляет автономную, функциональную часть белка (несущую одну из его функций) и часто «вырезав» из гена отдельный домен, можно получить растворимый белок, определить его структуру и провести с ним опыты. Люди пытаются использовать машинное обучение (нейронные сети, SVM и прочие классификаторы), чтобы предсказывать растворимость белка, однако работает оно достаточно плохо (Гугл много чего покажет по запросу “protein solubility prediction” – есть много серверов, но по моему опыту все они работают отвратительно на моих белках). В идеале я хотел бы видеть сервис, который надежно сказал бы, где в белке находятся те самые растворимые домены, чтобы их можно было вырезать и работать с ними – такого сервиса нет.

На уровне вторичной структуры – предсказание той самой вторичной структуры по первичной (JPred)

На уровне третичной структуры – поиск белков со сходными трехмерными структурами (DALI, en.wikipedia.org/wiki/Structural_alignment ),
Поиск структур по заданной суб-структуре. Например, у меня есть расположение трех аминокислот активного центра в пространстве. Хочу найти структуры, которые содержать такие же три аминокислоты в таком же относительном расположении, либо найти структуры белков, мутирование которых даст возможность расположить нужные аминокислоты нужным образом. (гуглить «protein substructure search»)
Предсказание потенциальной подвижности трехмерной структуры, возможных конформационных изменений – normal mode analysis, ElNemo.

На уровне четвертичной структуры – предположим, известны структуры двух белков. Известно, что они образуют комплекс. Предсказать структуру комплекса (определить, как эти два белка будут взаимодействовать посредством shape matching, например). Гуглить «protein-protein docking»

6. Предсказание структуры белка

Выделил эту вычислительную задачу в отдельный раздел, ибо велика она, фундаментальна и не решается в общем случае.

Экспериментально мы знаем, что если взять белок, полностью развернуть его и бросить в воду, то он свернется обратно в исходное состояние за время от миллисекунд до секунд (это утверждение справедливо по крайней мере для небольших глобулярных белков без всяких патологий). Это значит, что вся информация, необходимая для определения трехмерной структуры белка, в неявном виде содержится в его первичной последовательности, поэтому так хочется научиться предсказывать трехмерную структуру белка по последовательности аминокислот in silico! Однако эта задача в общем случае не решена до сих пор. В чем же дело? Дело в том, что в первичной последовательности отсутствует в явном виде информация, необходимая для построения структуры. Во-первых, нет информации о конформации основной цепи – а она обладает значительной подвижностью, хотя и несколько ограниченной по стерическим причинам. Плюс каждая боковая цепь каждой аминокислоты может находиться в разных конформациях, для длинных боковых групп типа аргинина, это может быть больше десятка конформаций.

Что же делать? Есть достаточно известный хабравчанам самый общий подход, называемый «молекулярная динамика» и подходящий для любых молекул и систем. Берем развернутый белок, приписываем всем атомам случайные значения скоростей, считаем взаимодействия между атомами, повторяем до тех пор, пока система не придет в стабильное состояние, соответствующее свернутому белку. Почему это не работает? Потому что современные вычислительные мощности позволяют за месяцы работы кластера считать десятки наносекунд для системы из тысяч атомов, какой является белок, помещенный в воду. Время же сворачивания белка – миллисекунды и больше, то есть вычислительных мощностей не хватает, разрыв – в несколько порядков. Впрочем, пару лет назад американцы совершили некоторый прорыв. Они использовали специальное железо, оптимизированное для векторных вычислений и после оптимизации на аппаратном уровне у них за месяцы работы машины получилось посчитать молдинамику до миллисекунд для очень маленького белка и белок свернулся, структура соответствовала экспериментально определенной ( http://en.wikipedia.org/wiki/Anton_(computer) )! Однако праздновать победу еще рано. Они взяли очень маленький (его размер раз в 5-10 меньше среднего белка) и один из самых быстросворачивающихся белков, классический модельный белок, на котором изучалось сворачивание. Для больших белков время расчетов увеличивается нелинейно и потребуются уже годы, то есть еще есть над чем работать.

Другой подход реализован в Rosetta. Они разбивают последовательность белка на очень короткие (3-9 остатков) фрагменты и смотрят, какие конформации для этих фрагментов присутствуют в PDB, после чего запускают Монте-Карло по всем вариантам и смотрят, что получится. Иногда получается что-то годное, но в моих случаях через несколько дней работы кластера получаешь такой бублик, что возникает немой вопрос: «Кто писал их оценочную функцию, ставящую какую-то хорошую оценку вот этой загогулине?».

Есть инструменты и для моделирования вручную – можно предсказать вторичную структуру и попробовать вручную крутить ее, находя лучшую укладку. Некие гениальные люди даже выпустили игрушку FoldIt, представляющую белок схематично и позволяющую укладывать его, как-бы собирая головоломку (для интересующихся структурой – рекомендую!). Есть абсолютно официальное соревнование для предсказателей белковых структур, называемое CASP. Суть в том, что когда экспериментаторы определяют новую структуру белка, не имеющую аналогов в PDB, они могут не выкладывать ее сразу в PDB, а выставить последовательность этого белка на конкурс предсказаний CASP. Через некоторое время, когда все закончат свои предсказательные модели, экспериментаторы выкладывают свою экспериментально определенную структуру белка и смотрят, насколько хорошо сработали предсказатели. Самое интересное, что игроки FoldIt, не будучи учеными, как-то выиграли CASP у профессионалов моделирования белковых структур и предсказали структуру белка точнее. Однако даже эти успехи не позволяют утверждать, что проблема предсказания структуры белка решается – очень часто модель очень далека от реальной структуры.

Все это относилось к моделированию белков ab initio, когда нет никакой априорной информации о структуре. Однако очень часто бывают ситуации, когда для некоторого белка в PDB присутствует его отдаленный родственник с уже известной структурой. Под родственником подразумевается белок с похожей первичной последовательностью. Считается, что для белков со сходством по первичной последовательности больше 30% одинаковая укладка основной цепи (хотя одинаковая укладка наблюдалась и для белков, не проявляющих никакого статистически достоверного сходства по первичной последовательности). В случае наличия гомолога (похожего белка) с известной структурой, можно сделать «гомологичное моделирование», то есть попросту «натянуть» последовательность твоего белка на известную структуру гомолога, а потом погонять минимизацию энергии, чтобы как-то все это дело утрясти. Такое моделирование показывает хорошие результаты при наличие очень близких гомологов, чем дальше гомолог – тем больше ошибка. Инструменты для гомологичного моделирования – Modeller, SwissModel.

Можно решать и другие задачи, например, пытаться моделировать, что произойдет, если внести в белок ту или иную мутацию. Например, если заменить гидрофильную аминокислоту на поверхности белка на другую гидрофильную, то скорее всего структура белка не изменится вообще. Если заменить аминокислоту из гидрофобного ядра на другую гидрофобную, но другого размера, то скорее всего укладка белка останется той же, но слегка «съедет» на доли ангстрема. Если же заменить аминокислоту из гидрофобного ядра на заряженную, то скорее всего белок просто «взорвется» и не сможет свернуться.

Может показаться, что все не так уж и плохо и мы достаточно хорошо пониманием сворачивание белка. Да, мы понимаем кое-что, например до некоторой степени мы понимаем общие физические принципы, лежащие в основе сворачивания полипептидной цепи – они рассматриваются в замечательном учебнике Птицына и Финкельштейна «Физика белка». Однако это общее понимание не позволяет нам ответить на вопросы «Свернется ли данный белок или не свернется?», «Какая структура будет у этого белка?», «Как сделать белок с желаемой структурой?».

Вот одна из иллюстраций: мы хотим локализовать один из доменов большого белка, это стандартная задача. У нас есть фрагмент, который сворачивается и растворим, то есть это живой и здоровый белок. Мы же хотим найти его минимальную часть и начинаем методами генетической инженерии с обоих концов удалять по 2-3 аминокислоты, экспрессировать такой обрезанный белок в бактерии и смотреть его сворачиваемость экспериментально. Мы делаем десятки конструкций с такими маленькими делециями и видим такую картину – полностью растворимый и живой белок отличается от полностью мертвого и несворачивающегося на 3 аминокислоты. Повторюсь, это объективный экспериментальный результат. Проблема в том, что сейчас не существует вычислительного метода, который предсказал бы сворачиваемость белка хотя бы на уровне «да/нет» и сказал мне, где проходит граница между сворачивающимся и несворачивающимся белком, потому мы вынуждены клонировать и экспериментально проверять десятки вариантов. Это лишь одна из иллюстраций того, что наше понимание структуры белка весьма далеко от совершенства. Как говорил Ричард Фейнман, «Чего не могу воссоздать, того не понимаю».

Так что, господа программисты, физики и математики, нам еще есть над чем работать.

На этой оптимистичной ноте разрешите откланяться, благодарю всех, кто осилил сей опус.

Для глубоко знакомства с предметной областью рекомендую следующий минимум:
1) «Физика белка» Птицын и Финкельштейн. Большую часть материала Алексей Витальевич Финкельштейн выложил в онлайн, чем и рекомендую с благодарностью воспользоваться: phys.protres.ru/lectures/protein_physics/index.html (а я утащил оттуда несколько картинок)
2) Патрушев, «Искусственные генетические системы», особенно часть II «Белковая инженерия». Есть на торрентах в формате Djvu
3) Для информации, опубликованной в биологических научных журналах, есть официальный поисковик PubMed ( www.pubmed.org ) — у него стоит попросить почитать про «protein engineering» и тому подобное.

Синтез белков в клетке — описание, функции процесса. Биосинтез белка: кратко и понятно. Биосинтез белка в живой клетке Что такое биосинтез белков

Белки играют очень важную роль в жизнедеятельности организмов, выполняют защитные, структурные, гормональные, энергетические функции. Обеспечивают рост мышечной и костной ткани. Белки информируют о строении клетки, о её функциях и биохимических свойствах, входят в состав ценных, полезных организму продуктов питания (яиц, молочных продуктов, рыбы, орехов, бобовых, ржи и пшеницы). Усвояемость такой пищи объясняется биологической ценностью. При равном показателе количества белка легче будет усваиваться тот продукт, чья ценность выше. Дефектные полимеры должны удаляться из организма и заменяться новыми. Этот процесс протекает при синтезе белков в клетках.

Какими бывают белки

Вещества, состоящие только из остатков аминокислот, называются простыми белками (протеинами). В случае необходимости используется их энергетическое свойство, поэтому людям, ведущим здоровый образ жизни, зачастую дополнительно нужен прием протеина. Сложные же белки, протеиды, имеют в своем составе простой белок и небелковую часть. Десять аминокислот в белке являются незаменимыми, это означает, что организм не может синтезировать их самостоятельно, они поступают из пищи, другой же десяток — заменимый, то есть их можно создать из других аминокислот. Так начинается жизненно необходимый для всех организмов процесс.

Основные этапы биосинтеза: откуда берутся белки

Новые молекулы берутся в результате биосинтеза — химической реакции соединения. Существует два основных этапа синтеза белков в клетке. Это транскрипция и трансляция. Транскрипция происходит в ядре. Это считывание с ДНК (дезоксирибонуклеиновой кислоты), которая несет информацию о будущем белке, на РНК (рибонуклеиновую кислоту), которая переносит эту информацию с ДНК в цитоплазму. Происходит это по причине того, что ДНК непосредственно в биосинтезе участия не принимает, она только несет сведения, не имея способности выходить в цитоплазму, где синтезируется белок, и выполняя только функцию носителя генетической информации. Транскрипция же позволяет считать данные с матрицы ДНК на РНК по принципу комплементарности.

Роль РНК и ДНК в процессе

Итак, запускает синтез белков в клетках цепочка ДНК, которая несет информацию о каком-либо конкретном белке и называется геном. Цепочка ДНК в процессе транскрипции расплетается, то есть её спираль начинает распадаться в линейную молекулу. С ДНК информация должна преобразоваться на РНК. Напротив тимина в данном процессе должен становиться аденин. Цитозин же имеет в качестве пары гуанин, точно так же, как ДНК. Напротив аденина РНК становится урацил, потому как в РНК такого нуклеотида, как тимин, не существует, он заменяется просто урациловым нуклеотидом. С гуанином соседствует цитозин. Напротив аденина становится урацил, а в паре с тимином располагается аденин. Эти молекулы РНК, которые становятся напротив, называются информационными РНК (иРНК). Они способны через поры выходить из ядра в цитоплазму и рибосомы, которые, собственно, и выполняют функцию синтеза белков в клетках.

О сложном простыми словами

Теперь же совершается сборка из аминокислотных последовательностей полипептидной цепочки белка. Транскрипцией можно назвать считывание информации о будущем белке с матрицы ДНК на РНК. Это можно определить как первый этап. После того как РНК выходит из ядра, она должна попасть к рибосомам, где происходит второй этап, который называется трансляцией.

Трансляция — это уже переход РНК, то есть перенос информации с нуклеотидов на молекулу белка, когда РНК говорит о том, какая последовательность аминокислот должна быть в веществе. В таком порядке информационная РНК попадает в цитоплазму к рибосомам, которые осуществляют синтез белков в клетке: А (аденин) — Г (гуанин) — У (урацил) — Ц (цитозин) — У (урацил) — А (аденин).

Зачем нужны рибосомы

Для того чтобы произошла трансляция и в результате образовался белок, нужны такие компоненты, как сама информационная РНК, транспортная РНК, а также рибосомы в качестве «фабрики», на которой производится белок. В данном случае функционируют две разновидности РНК: информационная, которая образовалась в ядре с ДНК, и транспортная. Молекула второй кислоты имеет вид клевера. Этот «клевер» присоединяет к себе аминокислоту и несет её к рибосомам. То есть он выполняет транспортировку органических соединений непосредственно к «фабрике» по их образованию.

Как работает рРНК

Также существуют рибосомальные РНК, которые входят в состав самой рибосомы и выполняют синтез белка в клетке. Получается, что рибосомы являются немембранными структурами, они не имеют оболочек, как, например, ядро или эндоплазматическая сеть, а состоят просто из белков и рибосомальных РНК. Что же происходит, когда последовательность из нуклеотидов, то есть информационная РНК, попадает к рибосомам?

Транспортная РНК, которая находится в цитоплазме, подтягивает к себе аминокислоты. Откуда же взялись аминокислоты в клетке? А образуются они вследствие расщепления белков, которые поступают внутрь с пищей. Эти соединения переносятся током крови к клеткам, где происходит продуцирование необходимых для организма белков.

Конечный этап синтеза белков в клетках

Аминокислоты плавают в цитоплазме так же, как и транспортные РНК, и когда происходит непосредственно сборка полипептидной цепи, эти транспортные РНК начинают с ними соединяться. Однако не во всякой последовательности и далеко не любая транспортная РНК может соединиться со всеми видами аминокислот. Существует определенный участок, к которому присоединяется необходимая аминокислота. Второй же участок транспортной РНК называется антикодоном. Этот элемент состоит из трех нуклеотидов, которые комплементарны последовательности нуклеотидов в информационной РНК. Для одной аминокислоты необходимо три нуклеотида. Например, какой-либо условный белок состоит для упрощения из всего лишь двух аминокислот. Очевидно, что в основном белки имеют очень длинную структуру, состоят из многих аминокислот. Цепь А — Г — У называется триплетом, или кодоном, к нему будет присоединяться транспортная РНК в виде клевера, на конце которого будет находиться определенная аминокислота. К следующему триплету Ц — У — А будет присоединяться еще одна тРНК, которая будет содержать совершенно другую аминокислоту, комплементарную данной последовательности. В таком порядке будет происходить дальнейшая сборка полипептидной цепочки.

Биологическое значение синтеза

Между двумя аминокислотами, находящимися на концах «клеверов» каждого триплета, образуется пептидная связь. На этом этапе транспортная РНК уходит в цитоплазму. К триплетам присоединяется затем следующая транспортная РНК с другой аминокислотой, которая образует с предыдущими двумя полипептидную цепь. Этот процесс повторяется до момента, когда набирается необходимая последовательность аминокислот. Таким образом происходит синтез белка в клетке, и образуются ферменты, гормоны, кровяные вещества и т. д. Не во всякой клетке образуется любой белок. Каждая клетка может образовать определенный белок. Например, в эритроцитах будет образовываться гемоглобин, а клетками поджелудочной железы будут синтезироваться гормоны и разнообразные ферменты, расщепляющие пищу, которая попадает в организм.

В мышцах же будет образовываться белок актин и миозин. Как видно, процесс синтеза белка в клетках многоэтапен и сложен, что говорит о его значимости и необходимости для всего живого.

Биосинтез белков в клетках представляет собой последовательность реакций матричного типа, в ходе которых последовательная передача наследственной информации с одного типа молекул на другой приводит к образованию полипептидов с генетически обусловленной структурой.

Биосинтез белков представляет собой начальный этап реализации, или экспрессии генетической информации. К главным матричным процессам, обеспечивающим биосинтез белков, относятся транскрипция ДНК и трансляция мРНК. Транскрипция ДНК заключается в переписывании информации с ДНК на мРНК (матричную, или информационную РНК). Трансляция мРНК заключается в переносе информации с мРНК на полипептид. Последовательность матричных реакций при биосинтезе белков можно представить в виде схемы.

нетранскрибируемая цепь ДНК

транскрибируемая цепь ДНК

транскрипция ДНК

кодоны мРНК

трансляция мРНК

антикодоны тРНК

аминокислоты белка

метионин

На схеме видно, что генетическая информация о структуре белка хранится в виде последовательности триплетов ДНК. При этом лишь одна из цепей ДНК служит матрицей для транскрипции (такая цепь называется транскрибируемой). Вторая цепь является комплементарной по отношению к транскрибируемой и не участвует в синтезе мРНК.

Молекула мРНК служит матрицей для синтеза полипептида на рибосомах. Триплеты мРНК, кодирующие определенную аминокислоту, называются кодоны. В трансляции принимают участие молекулы тРНК. Каждая молекула тРНК содержит антикодон – распознающий триплет, в котором последовательность нуклеотидов комплементарна по отношению к определенному кодону мРНК. Каждая молекула тРНК способна переносить строго определенную аминокислоту. Соединение тРНК с аминокислотой называется аминоацил–тРНК.

Молекула тРНК по общей конформации напоминает клеверный лист на черешке. «Вершина листа» несет антикодон. Существует 61 тип тРНК с разными антикодонами. К «черешку листа» присоединяется аминокислота (существует 20 аминокислот, участвующих в синтезе полипептида на рибосомах). Каждой молекуле тРНК с определенным антикодоном соответствует строго определенная аминокислота. В то же время, определенной аминокислоте обычно соответствует несколько типов тРНК с разными антикодонами. Аминокислота ковалентно присоединяется к тРНК с помощью ферментов – аминоацил-тРНК-синтетаз. Эта реакция называется аминоацилированием тРНК.

На рибосомах к определенному кодону мРНК с помощью специфического белка присоединяется антикодон соответствующей молекулы аминоацил-тРНК. Такое связывание мРНК и аминоацил-тРНК называется кодонзависимым. На рибосомах аминокислоты соединяются между собой с помощью пептидных связей, а освободившиеся молекулы тРНК уходят на поиски свободных аминокислот.

Рассмотрим подробнее основные этапы биосинтеза белков.

1 этап. Транскрипция ДНК. На транскрибируемой цепи ДНК с помощью ДНК-зависимой РНК-полимеразы достраивается комплементарная цепь мРНК. Молекула мРНК является точной копией нетранскрибируемой цепи ДНК с той разницей, что вместо дезоксирибонуклеотидов в ее состав входят рибонуклеотиды, в состав которых вместо тимина входит урацил.

2 этап. Процессинг (созревание) мРНК. Синтезированная молекула мРНК (первичный транскрипт) подвергается дополнительным превращениям. В большинстве случаев исходная молекула мРНК разрезается на отдельные фрагменты. Одни фрагменты – интроны – расщепляются до нуклеотидов, а другие – экзоны – сшиваются в зрелую мРНК. Процесс соединения экзонов «без узелков» называетсясплайсинг.

Сплайсинг характерен для эукариот и архебактерий, но иногда встречается и у прокариот. Существует несколько видов сплайсинга. Сущность альтернативного сплайсинга заключается в том, что одни и те же участки исходной мРНК могут быть и интронами, и экзонами. Тогда одному и тому же участку ДНК соответствует несколько типов зрелой мРНК и, соответственно, несколько разных форм одного и того же белка. Сущность транс–сплайсинга заключается в соединение экзонов, кодируемых разными генами (иногда даже из разных хромосом), в одну зрелую молекулу мРНК.

3 этап. Трансляция мРНК. Трансляция (как и все матричные процессы) включает три стадии: инициацию (начало), элонгацию (продолжение) и терминацию (окончание).

Инициация. Сущность инициации заключается в образовании пептидной связи между двумя первыми аминокислотами полипептида.

Первоначально образуется инициирующий комплекс, в состав которого входят: малая субъединица рибосомы, специфические белки (факторы инициации) и специальная инициаторная метиониновая тРНК с аминокислотой метионином – Мет–тРНКМет. Инициирующий комплекс узнает начало мРНК, присоединяется к ней и скользит до точки инициации (начала) биосинтеза белка: в большинстве случаев это стартовый кодон АУГ. Между стартовым кодоном мРНК и антикодоном метиониновой тРНК происходит кодонзависимое связывание с образованием водородных связей. Затем происходит присоединение большой субъединицы рибосомы.

При объединении субъединиц образуется целостная рибосома, которая несет два активных центра (сайта): А–участок (аминоацильный, который служит для присоединения аминоацил-тРНК) и Р–участок (пептидилтрансферазный, который служит для образования пептидной связи между аминокислотами).

Первоначально Мет–тРНКМет находится на А–участке, но затем перемещается на Р–участок. На освободившийся А–участок поступает аминоацил-тРНК с антикодоном, который комплементарен кодону мРНК, следующему за кодоном АУГ. В нашем примере это Гли–тРНКГли с антикодоном ЦЦГ, который комплементарен кодону ГГЦ. В результате кодонзависимого связывания между кодоном мРНК и антикодоном аминоацил-тРНК образуются водородные связи. Таким образом, на рибосоме рядом оказываются две аминокислоты, между которыми образуется пептидная связь. Ковалентная связь между первой аминокислотой (метионином) и её тРНК разрывается.

После образования пептидной связи между двумя первыми аминокислотами рибосома сдвигается на один триплет. В результате происходит транслокация (перемещение) инициаторной метиониновой тРНКМет за пределы рибосомы. Водородная связь между стартовым кодоном и антикодоном инициаторной тРНК разрывается. В результате свободная тРНКМет отщепляется и уходит на поиск своей аминокислоты.

Вторая тРНК вместе с аминокислотой (в нашем примере Гли–тРНКГли) в результате транслокации оказывается на Р–участке, а А–участок освобождается.

Элонгация. Сущность элонгации заключается в присоединении последующих аминокислот, то есть в наращивании полипептидной цепи. Рабочий цикл рибосомы в процессе элонгации состоит из трех шагов: кодонзависимого связывания мРНК и аминоацил-тРНК на А–участке, образования пептидной связи между аминокислотой и растущей полипептидной цепью и транслокации с освобождением А–участка.

На освободившийся А–участок поступает аминоацил-тРНК с антикодоном, соответствующим следующему кодону мРНК (в нашем примере это Тир–тРНКТир с антикодоном АУА, который комплементарен кодону УАУ).

На рибосоме рядом оказываются две аминокислоты, между которыми образуется пептидная связь. Связь между предыдущей аминокислотой и её тРНК (в нашем примере между глицином и тРНКГли) разрывается.

Затем рибосома смещается еще на один триплет, и в результате транслокации тРНК, которая была на Р–участке (в нашем примере тРНКГли), оказывается за пределами рибосомы и отщепляется от мРНК. А–участок освобождается, и рабочий цикл рибосомы начинается сначала.

Терминация. Заключается в окончании синтеза полипептидной цепи.

В конце концов, рибосома достигает такого кодона мРНК, которому не соответствует ни одна тРНК (и ни одна аминокислота). Существует три таких нонсенс–кодона: УАА («охра»), УАГ («янтарь»), УГА («опал»). На этих кодонах мРНК рабочий цикл рибосомы прерывается, и наращивание полипептида прекращается. Рибосома под воздействием определенных белков вновь разделяется на субъединицы.

Модификация белков. Как правило, синтезированный полипептид подвергается дальнейшим химическим превращениям. Исходная молекула может разрезаться на отдельные фрагменты; затем одни фрагменты сшиваются, другие гидролизуются до аминокислот. Простые белки могут соединяться с самыми разнообразными веществами, образуя гликопротеины, липопротеины, металлопротеины, хромопротеины и другие сложные белки. Кроме того, аминокислоты уже в составе полипептида могут подвергаться химическим превращениям. Например, аминокислота пролин, входящая в состав белка проколлагена, окисляется до гидроксипролина. В результате из проколлагена образуется коллаген – основной белковый компонент соединительной ткани.

Реакции модификации белков не являются реакциями матричного типа. Такие биохимические реакции называются ступенчатыми.

Энергетика биосинтеза белков. Биосинтез белков – очень энергоемкий процесс. При аминоацилировании тРНК затрачивается энергия одной связи молекулы АТФ, при кодонзависимом связывании аминоацил-тРНК – энергия одной связи молекулы ГТФ, при перемещении рибосомы на один триплет – энергия одной связи еще одной молекулы ГТФ. В итоге на присоединение аминокислоты к полипептидной цепи затрачивается около 90 кДж/моль. При гидролизе же пептидной связи высвобождается лишь 2 кДж/моль. Таким образом, при биосинтезе большая часть энергии безвозвратно теряется (рассеивается в виде тепла).

Генетический код, его основные свойства

В ходе реакций матричного синтеза на основании генетического кода синтезируется полипептид с наследственно обусловленной структурой. Отрезок ДНК, содержащий информацию о структуре определенного полипептида, называется ген.

Однако, ген – это не просто участок ДНК, а единица наследственной информации, носителем которой являются нуклеиновые кислоты. Установлено, что ген имеет сложную структуру.

В большинстве случаев кодирующие участки (экзоны) разделены некодирующими (интронами). В то же время, благодаря альтернативному сплайсингу, деление участка ДНК на кодирующие и некодирующие оказывается условным. Некоторые участки ДНК могут перемещаться относительно друг друга – их называют мобильными генетическими элементами (МГЭ). Многие гены представлены несколькими копиями – тогда один и тот же белок кодируется разными участками ДНК. Еще сложнее закодирована генетическая информация у вирусов. У многих из них обнаружены перекрывающиеся гены: один и тот же участок ДНК может транскрибироваться с разных стартовых точек.

Процесс экспрессии генов обладает гибкостью: одному участку ДНК может соответствовать несколько полипептидов; один полипептид может кодироваться разными участками ДНК. Окончательная модификация белков происходит с помощью ферментов, которые кодируются различными участками ДНК.

Общие свойства генетического кода

Отражение одних объектов с помощью других называется кодированием. Отражение структуры белков в виде триплетов ДНК называется кодом ДНК, или генетическим кодом. Благодаря генетическому коду устанавливается однозначное соответствие между нуклеотидными последовательностями нуклеиновых кислот и аминокислотами, входящими в состав белков. Генетический код обладает следующими основными свойствами:

1. Генетический код триплетен: каждая аминокислота кодируется триплетом нуклеотидов ДНК и соответствующим триплетом иРНК. При этом кодоны ничем не отделены друг от друга (отсутствуют «запятые»).

2. Генетический код является избыточным (вырожденным): почти все аминокислоты могут кодироваться разными кодонами. Только двум аминокислотам соответствует по одному кодону: метионину (АУГ) и триптофану (УГГ). Зато лейцину, серину и аргинину соответствует по 6 разных кодонов.

3. Генетический код является неперекрывающимся: каждая пара нуклеотидов принадлежит только одному кодону (исключения обнаружены у вирусов).

4. Генетический код един для подавляющего большинства биологических систем. Однако имеются и исключения, например, у инфузорий и в митохондриях разных организмов. Поэтому генетический код называют квазиуниверсальным.

Биосинтез белков (полипептидов) является чрезвычайно сложным и удивительным процессом. Биосинтез белков активно протекает во всех органах и тканях, исключая эритроциты. Многие клетки синтезируют белки на «экспорт» (клетки печени, поджелудочной железы), и в этом случае они содержат очень большое число рибосом. В животной клетке число рибосом достигает 10 5 , диаметр рибосомы равен 20 нм.

Процесс синтеза белка происходит внутри клеток на поверхности рибосом, которые представляют собой комплексы из двух субъединиц с константой седиментации 60S и 40S, функционирующих как единое целое. В рибосоме белок составляет 30-35% и рибосомальная РНК — 65-70%. В рибосоме различают аминоацильный и пептидильный участки. Первый служит для фиксации поступающего на рибосому комплекса активной аминокислоты и тРНК, а второй фиксирует полипептидную цепь, связанную с другой тРНК. Субъединицы рибосом синтезируются в ядрышке ядра на матрице ДНК.

Сущность процесса синтеза белка представляет схема:

Белоксинтезирующая система включает рибосомы, нуклеиновые кислоты, набор из 20 аминокислот, различные ферменты, АТФ, ГТФ, ионы магния, около 200 различных некаталитических белковых факторов.

Молекула белка — длинная цепь аминокислотных остатков, насчитывающая в среднем от 100 до 500 аминокислот. Программа синтеза каждого белка хранится в молекуле дезоксирибонуклеиновой кислоты (ДНК). Молекула ДНК — полимер, мономерами которого служат нуклеотиды. Последовательность азотистых оснований в молекуле ДНК определяет последовательность аминокислот в молекуле белка.

В молекуле ДНК имеются четыре вида азотистых оснований: аденин (А), гуанин (Г), цитозин (Ц) и тимин (Т). Последовательность из трех оснований (триплет) составляет кодон, которому соответствует одна определенная аминокислота.

Нуклеиновые кислоты — ДНК и РНК — обязательные компоненты биосинтеза белков. ДНК отвечает за сохранение генетической информации, тогда как РНК определяет передачу этой информации и реализацию в виде молекул белка. Можно утверждать, что главная функция ДНК — это сохранение генотипа, а РНК — выражение этого генотипа.

В количественном плане в клетке преобладает рибосомаль- ная РНК (рРНК). рРНК имеет спирализованные участки, содержит модифицированные нуклеотиды (например, 2-метил- рибоза). рРНК составляет около 80% от общего количества РНК в клетке. Второй вид РНК в клетке представлен транспортной РНК (тРНК), которая, как и все другие виды РНК, синтезируется в ядре. На ее долю приходится 10-15% общего количества РНК в клетке. Выявлено свыше 60 различных тРНК. Поэтому для транспорта отдельных аминокислот существует несколько разных тРНК. Для каждой аминокислоты в клетке есть по крайней мере одна специфическая тРНК. Молекулы тРНК сравнительно мелкие. В их структуре 75-93 рибонук- леотидов.

Аминокислота присоединяется к свободной 3-ОН-группе концевого мононуклеотида тРНК, представленной всегда аде- ниловой кислотой. тРНК имеет и другой важный участок — антикодон, с помощью которого комплекс аминокислоты и тРНК узнает определенную последовательность из трех нуклеотидов в матричной РНК (кодон). Антикодон и кодон комплементарно соединяются посредством водородных связей.

Если носителем наследственной информации в клетке является ДНК, которая сосредоточена в ядре, но синтез белка происходит в цитоплазме, то, следовательно, должен быть определенный посредник, передающий эту информацию в цитоплазму клетки. Этим посредником оказалась информационная или матричная РНК (мРНК). На долю мРНК приходится 2% общего количества РНК клетки. Молекулы мРНК самые длинные (включают до 5 тыс. нуклеотидов). мРНК также содержит четыре вида азотистых оснований. Из них три (А, Г, Ц) такие же, как в ДНК, а четвертое — урацил.

Информация, закодированная в мРНК, необходима для синтеза молекулы белка, который происходит на рибосомах. Синтез мРНК в ядре клетки очень быстрый, что необходимо для активного биосинтеза белковых молекул. мРНК образуется на одной из нитей ДНК ядра. При этом двухспиральная структура ДНК раскручивается и при участии ДНК-зависимой РНК-по- лимеразы по принципу комплементарности происходит синтез мРНК:


Схема синтеза мРНК

Принцип комплементарности означает, что аденину на спирали ДНК соответствует урацил мРНК, тимину — аденин, а гуанину — цитозин. Следовательно, мРНК считывает информацию с ДНК.

Стадия ДНК -» РНК, таким образом, определяет синтез молекулы мРНК, в которой нуклеотидная последовательность комплементарна определенному участку (гену) ДНК. Этот процесс носит название транскрипции. Затем мРНК поступает на рибосому, объединяясь с ее субъединицами. Одна молекула мРНК фиксируется на множестве рибосом одновременно, образуя так называемые полисомы. Наличие полисом повышает эффективность и скорость использования мРНК.

Синтез полипептидной цепи определенного состава происходит на матрице мРНК. Процесс передачи информации с мРНК на белок получил название трансляции. Стадия «РНК -> белок » представляет процесс синтеза белка, направляемый мРНК. Таким образом, передача информации всегда идет в направлении ДНК -» РНК -» белок.

Процесс трансляции включает следующие этапы:

  • 1) активация аминокислот и их фиксация на тРНК;
  • 2) инициация синтеза полипептидной цепи;
  • 3) элонгация синтезируемой полипептидной цепи;
  • 4) терминация полипептидной цепи и ее освобождение;
  • 5) посттрансляционная модификация полипептидной цепи.
  • 1. Активация аминокислот требует фермента аминоацил- тРНК-синтетазы и затраты энергии в виде АТФ:

Этот же фермент участвует в фиксации предварительно активированной аминокислоты в положение 2 или 3 рибозы последнего нуклеотида тРНК:

В виде данного комплекса аминокислота транспортируется на рибосому, на которой происходит синтез белковой молекулы. Аминоацил-тРНК-синтетаза специфична, она способна узнавать как аминокислоту, так и тРНК. В клетке, таким образом, имеется не менее 20 различных синтетаз, в соответствии с числом а-аминокислот.

2. тРНК, связанная эфирной связью с определенной аминокислотой, поступает на рибосому и взаимодействует с мРНК по типу комплементарности между специфическим триплетом нуклеотидов мРНК, названным кодоном, и ей комплементарным специфическим триплетом нуклеотидов (антикодоном) тРНК, переносящей определенную аминокислоту. Таким образом, каждый кодон мРНК соответствует специфической фиксации одной аминокислоты в пептидной цепи посредством антикодона тРНК. Рибосома передвигается вдоль молекулы мРНК, считывая последовательно все кодоны, устанавливая таким образом порядок расположения всех аминокислот, доставляемых к месту синтеза.

Синтез молекулы белка идет по направлению от свободной аминогруппы к свободной карбоксильной группе аминокислоты. Обычно начальной аминокислотой в синтезе полипептид- ной цепи является метионин, для которой кодоном служит нуклеотидная последовательность АУГ мРНК.

Инициация синтеза полипептида начинается при фиксации двух антикодонов тРНК по соответствующим кодонам мРНК. Процесс требует наличия источника энергии, которым служит ГТФ, а также участия целого ряда белковых факторов инициации и пептидилтрансферазы.

При участии данного фермента скорость образования ковалентных связей достигает 1200 аминокислот/мин/рибосому.


Схема инициации синтеза полипептида

3. После образования дипептида «ненагруженная» тРНК покидает рибосому и способна доставлять новые молекулы аминокислот, а мРНК продвигается относительно рибосомы (полисомы) на три нуклеотида. В результате перемещения (транслокации) свободный кодон занимает положение для узнавания очередной молекулы тРНК. Следовательно, в стадии элонгации происходит последовательное присоединение по одной аминокислоте к полипептидной цепи в строгом соответствии с порядком кодонов молекулы мРНК.

Удлиняющаяся полипептидная цепь с одной молекулой тРНК фиксируется с большой субъединицей рибосомы. Присоединение каждой дополнительной аминокислоты к полипептидной цепи происходит за счет взаимосвязи аминогруппы присоединяющейся аминокислоты в комплексе с тРНК и карбоксильной группы пептида.

4. Терминация, или завершение синтеза полипептидной молекулы, вовлекает определенные кодоны терминации «без смысла» и белковые факторы терминации. Известны три кодона (УАГ, УГА, УАА), которые не кодируют, не связывают какую-либо аминокислоту, так как в клетке не существует антикодонов тРНК, комплементарных к ним. Теоретически лишь один кодон «без смысла», узнаваемый полисомой во время прохождения в направлении 5-3 мРНК, должен остановить синтез молекулы белка.

Наличие терминирующего кодона в любом участке мРНК означает окончание белкового синтеза. В результате полисома распадается, неиспользованная мРНК гидролизуется полинук- леотидфосфорилазой, а субъединицы рибосом готовятся к началу синтеза новой молекулы белка.

мРНК может неоднократно участвовать в процессе биосинтеза белка. Продолжительность функционирования молекулы мРНК неодинакова у различных организмов. Она может колебаться от нескольких минут до нескольких суток.

5. В ДНК закодирована лишь первичная структура белка. Поэтому синтезированные на рибосомах молекулы белков еще не имеют окончательно завершенного состояния. Они представляют первичные полипептиды, которые затем претерпевают многочисленные модификации (ассоциации мономеров с образованием олигомеров, присоединения коферментов, химические превращения), изменяющие структуру белков и, значит, их активность.

Вторичная и третичная структуры не кодированы, они определяются свойствами первичной структуры, а это значит, что та или иная форма белковой молекулы зависит от последовательности аминокислот и возможностей их взаимодействия между собой. Структурные модификации синтезируемых белков имеют место еще на уровне рибосом или после завершения синтеза в результате присоединения различных функциональных групп.

Рассмотренная схема передачи информации в виде

может в отдельных случаях изменяться. Так, у вирусов, не содержащих ДНК, информация заложена в РНК. При проникновении вируса в клетку эта информация передается на ДНК клетки, а последняя уже синтезирует мРНК, на матрице которой синтезируются вирусные белки. Такой процесс носит название обратной транскрипции, и схема передачи информации в этом случае будет следующей:

Пока сохраняется последовательность нуклеотидов ДНК и, следовательно, мРНК, характер вновь синтезируемого белка остается неизменным.

Необходимая генетическая информация для синтеза белка может быть представлена аналогично записи человеческого языка, которая состоит из последовательности букв, формирующих слова и предложения. В генетическом языке, однако, есть только четыре буквы — четыре основания (аденин, гуанин, урацил, цитозин).

Генетический код включает трехбуквенные слова. Четыре основания в данном случае (43) дают 64 варианта (слова), которых более чем достаточно, чтобы кодировать 20 аминокислот. Таким образом, 64 кодона и составляют генетический код (табл. 3).

Анализ генетического кода показывает, что для различных аминокислот имеется различное число кодонов. Например, метионин и триптофан имеют только один кодон, тогда как аргинин, лейцин, серин имеют по шесть кодонов. Наличие нескольких кодонов для одной аминокислоты отражает «вырожден- ность» кода. Следовательно, одна и та же аминокислота может кодироваться несколькими по своему строению нуклеотидными триплетами. В то же время каждому триплету соответствует вполне определенная аминокислота в синтезируемой поли- пептидной цепи.

Т а б л и ц а 3

Генетический код

нуклеотид

Второй нуклеотид

нуклеотид

Генетический код универсален и одинаков у видов разного уровня развития (человек, животные, растения, микроорганизмы). Универсальность кода свидетельствует, что все живые организмы в прошлом имели единого предка.

Отдельные аминокислоты (оксипролин, оксилизин), например, не имеют кодона и образуются с помощью химических реакций уже после синтеза полипептидной цепи. Этот процесс получил название посттрансляционной модификации и очень важен для правильного функционирования каждого белка.

Бессмысленные кодоны (УАА, УАГ, УГА) не кодируют аминокислоты, однако реально служат сигналом окончания синтеза белковой молекулы.

Таким образом, мРНК является непосредственным переносчиком генетической информации из ядра на рибосому цитоплазмы. Одна рибосома занимает на мРНК участок длиной около 80 нуклеотидов и способна катализировать примерно 100 пептидных связей в минуту (Северин Е. С. и др., 2011).

Синтезированные белковые молекулы могут подвергаться структурным модификациям еще на уровне рибосом или после завершения синтеза в результате присоединения различных функциональных групп. В цитоплазме мРНК имеет сравнительно короткий период существования. Некоторое количество мРНК синтезируется и запасается в неактивной форме, будучи готовой для быстрого синтеза белка. Поскольку информация мРНК связана с линейной последовательностью нуклеотидов, целостность этой последовательности чрезвычайно важна. Любая потеря или изменение порядка нуклеотидов может видоизменить синтез белка. На сегодня установлен целый ряд ингибиторов репликации ДНК в клетках организма (антибиотики, химические яды, антивирусные препараты). Повреждения в последовательности пуриновых или пиримидиновых оснований в гене получили название мутации.

Замена лишь одного нуклеотида в кодоне (мутация) приводит к смене кодирования одной аминокислоты на другую. Например, мутация, связанная с заменой глутаминовой кислоты на валин в молекуле гемоглобина, приводит к синтезу гемоглобина, вызывающего серповидную анемию. Сегодня известно более 200 мутаций полипептидной цепи молекулы гемоглобина человека. Часто мутагенами являются вещества (нитроза- мины, например), изменяющие структуру азотистых оснований, что приводит к изменению характера комплементарности оснований. Ультрафиолетовое облучение вызывает конденсацию остатков тимина с образованием тиминовых димеров. К счастью, от вредного действия ультрафиолетовых лучей животные защищены слоем озона атмосферы.

Многие антибиотики, используемые в ветеринарной практике, ингибируют бактериальный синтез белка (линкомицин, эритромицин, хлорамфеникол) еще на стадии трансляции. При этом микробная клетка погибает или приостанавливает свое развитие. Такие антибиотики, как тетрациклины, не влияют на рибосомальный синтез в клетках высших животных. Пени- циллины не являются прямыми ингибиторами синтеза белка, однако их эффекты ингибирования бактерий связаны с блокированием синтеза гексапептидов клеточной стенки. Следует отметить, что синтез белка происходит не только на рибосомах, но и в митохондриях. Митохондрии имеют полный и независимый аппарат синтеза белка для своих нужд, хотя не все митохондриальные белки синтезируются в этих органеллах. РНК митохондрий составляют лишь 3% от всего количества РНК клетки. Рибосомы митохондрий меньше по размерам, чем цитоплазматические. Кодон УГА, как терминатор синтеза белка в цитоплазме, используется в митохондриях наряду с кодоном УГГ для кодирования аминокислоты.

Синтезированные на рибосомах белки еще не имеют окончательно завершенного состояния. Они представляют первичные полипептиды, которые затем претерпевают многочисленные модификации (ассоциации мономеров с образованием олигомеров, присоединения коферментов, химические превращения), модифицирующие структуру белка и, значит, его активность.

Жизнь есть способ существования белковых тел. Это определение, данное Фридрихом Энгельсом, указывает на исключительную роль белков в функционировании организмов. Биосинтез белка — чрезвычайно сложный и энергозатратный процесс. Он является основой жизнедеятельности клетки.

Синтез белка осуществляется в рибосомах и проходит в несколько этапов по схеме ДНКРНК белок . Двухцепочечная молекула ДНК на основе принципа комплементарности транскрибируется в одноцепочечную молекулу РНК. В результате получается матричная РНК, которая содержит информацию об аминокислотной последовательности белка. Далее мРНК поступает в рибосому и по ней, как по матрице, синтезируется белок, путем перевода генетической информации с языка нуклеотидной последовательности на язык аминокислотной последовательности. Шаг за шагом строится полипептидная цепь, которая в процессе синтеза и после него модифицируется в биологически активный протеин. Синтезированный белок транспортируется в разные участки клетки для выполнения своих функций.

Кодирование аминокислотной последовательности белков осуществляется по определенным правилам, называемых генетическим кодом . Расшифровка генетического кода — очень значимое достижение науки. Код объясняет механизм синтеза белка, происхождение мутаций и другие биологические явления.

Рентгеноструктурный анализ и другие современные методы исследования позволили далеко продвинутся в изучении биосинтеза белка и других аспектов молекулярной биологии. Но тем не менее все еще не установлены пространственные структуры некоторых жизненно важных макромолекул. Науке предстоит ответить на многие вопросы, касающиеся белкового синтеза.

Общая схема биосинтеза белков в клетке: ДНКРНКбелок (Рисунок 1).

Рисунок 1. Общая схема биосинтеза белков в клетке

Транскрипция. Отдельные участки двухцепочечной ДНК (гены) служат матрицами для синтеза на них однотяжевых цепей РНК по принципу комплементарности. Транскрипция проходит в три стадии: инициация, элонгация, терминация.

Процессинг и транспорт. В процессе синтеза РНК подвергается изменениям, в результате которых превращается в зрелую молекулу, пригодную для синтеза белка. Получающаяся информационная (матричная) РНК (мРНК) затем поступает к рибосомам в качестве программы, определяющей аминокислотную последовательность в синтезируемом белке.

Активация и акцептирование аминокислот. Белки состоят из аминокислот, но свободные аминокислоты клетки не могут быть непосредственно использованы рибосомой. Каждая аминокислота сначала активируется с помощью АТФ, а затем присоединяется к специальной молекуле РНК — трансферной (транспортной) РНК (тРНК) вне рибосомы. Получающаяся аминоацил-тРНК поступает в рибосому в качестве субстрата для синтеза белка.

Трансляция. Поток информации в виде мРНК и поток материала в виде аминоацил-тРНК поступают в рибосомы, которые осуществляют перевод (трансляцию) генетической информации с языка нуклеотидной последовательности мРНК на язык аминокислотной. Каждая рибосома движется вдоль мРНК от одного конца к другому и соответственно выбирает из среды те аминоацил-тРНК, которые соответствуют (комплементарны) триплетным комбинациям нуклеотидов, находящимся в данный момент в рибосоме. Аминокислотный остаток выбранной аминоацил-тРНК каждый раз ковалентно присоединяется рибосомой к растущей полипептидной цепи, а деацилированная тРНК освобождается из рибосомы в раствор. Так последовательно строится полипептидная цепь.

Формирование функционального белка. По ходу синтеза полипептидная цепь высвобождается из рибосомы и сворачиваться в глобулу. Сворачивание и транспорт белка сопровождаются ферментативными модификациями (процессинг белка).

Несмотря на большую сложность аппарата биосинтеза белков, он протекает с чрезвычайно высокой скоростью. Синтез тысяч различных белков в каждой клетке строго упорядочен — при данных условиях метаболизма синтезируется лишь необходимое число молекул каждого белка.

Важнейшие функции организма — обмен веществ, рост, развитие, передача наследственности, движение и др. — осуществляются в результате множества химических реакций с участием белков, нуклеиновых кислот и других биологически активных веществ. При этом в клетках непрерывно синтезируются разнообразные соединения: строительные белки, белки-ферменты, гормоны. В ходе обмена эти вещества изнашиваются и разрушаются, а вместо них образуются новые. Поскольку белки создают материальную основу жизни и ускоряют все реакции обмена веществ, жизнедеятельность клетки и организма в целом определяется способностью клеток синтезировать специфические белки. Их первичная структура предопределена генетическим кодом в молекулеДНК.

Молекулы белков состоят из десятков и сотен аминокислот (точнее, из аминокислотных остатков). Например, в молекуле гемоглобина их около 600, и они распределены в четыре полипептидные цепочки; в молекуле рибонуклеазы таких аминокислот 124 и т. д.

Главная роль в определении первичной структуры белка принадлежит молекулам ДНК. Разные ее участки кодируют синтез разных белков, следовательно, одна молекула ДНК участвует в синтезе многих индивидуальных белков. Свойства белков зависят от последовательности аминокислот в полипептидной цепи. В свою очередь чередование аминокислот определяется последовательностью нуклеотидов в ДНК, и каждой аминокислоте соответствует определенный триплет. Экспериментально доказано, что, например, участок ДНК с триплетом ААЦ соответствует аминокислоте лейцину, триплет АЦЦ — триптофану, триплет АЦА-цистеину и т.д. Распределив молекулу ДНК на триплеты, можно представить, какие аминокислоты и в какой последовательности будут располагаться в молекуле белка. Совокупность триплетов составляет материальную основу генов, а каждый ген содержит информацию о структуре специфического белка (ген — это основная биологическая единица наследственности; в химическом отношении ген есть участок ДНК, включающий несколько сотен пар нуклеотидов).

Генетический код — исторически сложившаяся организация молекул ДНК и РНК, при которой последовательность нуклеотидов в них несет информацию о последовательности аминокислот в белковых молекулах. Свойства кода: триплетность (кодон), неперекрываемость (кодоны следуют друг за другом), специфичность (один кодон может определять в полииептидной цепи только одну аминокислоту), универсальность (у всех живых организмов один и тот же кодон обусловливает включение в полипептид одну и ту же аминокислоту), избыточность (для большинства аминокислот существует несколько кодонов). Триплеты, не несущие информации об аминокислотах, являются стоп триплетами, обозначающими место начала синтеза и-РНК. (В.Б. Захаров. Биология. Справочные материалы. М.,1997)

Поскольку ДНК находится в ядре клетки, а синтез белка происходит в цитоплазме, существует посредник, передающий информацию с ДНК на рибосомы. Таким посредником служит и РНК, на которую нуклеотидная последовательность переписывается, в точном соответствии с таковой на ДНК — по принципу комплементарности. Этот процесс получил название транскрипции и протекает как реакция матричного синтеза. Он характерен только для живых структур и лежит в основе важнейшего свойства живого — самовоспроизведения. Биосинтезу белка предшествует матричный синтез иРНК на нити ДНК. Возникшая при этом иРНК выходит из ядра клетки в цитоплазму, где на нее нанизываются рибосомы, сюда же с помощью тРЙК доставляются аминокислоты.

Синтез белка — сложный многоступенчатый процесс, в котором участвуют ДНК, иРНК, тРНК, рибосомы, АТФ и разнообразные ферменты. Вначале аминокисдоты в цитоплазме активируются с помощью ферментов и присоединяются к тРНК (к участку, где расположен нуклеотид ЦЦА). На следующем этапе идет соединение аминокислот в таком порядке, в каком чередование нуклеотидов с ДНК передано на иРНК. Этот этап называется трансляцией. На нити иРНК размещается не одна рибосома, а группа их — такой комплекс называется полисома (Н.Е. Ковалев, Л.Д. Шевчук, О.И. Щуренко. Биология для подготовительных отделений медицинских институтов).

Схема Биосинтез белка

Синтез белка состоит из двух этапов — транскрипции и трансляции.

I. Транскрипция (переписывание) — биосинтез молекул РНК, осуществляется в хромосомах на молекулах ДНК по принципу матричного синтеза. При помощи ферментов на соответствующих участках молекулы ДНК (генах) синтезируются все виды РНК (иРНК, рРНК, тРНК). Синтезируется 20 разновидностей тРНК, так как в биосинтезе белка принимают участие 20 аминокислот. Затем иРНК и тРНК выходят в цитоплазму, рРНК встраивается в субъединицы рибосом, которые также выходят в цитоплазму.

II. Трансляция (передача) — синтез полипептидных цепей белков, осуществляется в рибосомах. Она сопровождается следующими событиями:

1. Образование функционального центра рибосомы — ФЦР, состоящего из иРНК и двух субъединиц рибосом. В ФЦР всегда находятся два триплета (шесть нуклеотидов) иРНК, образующих два активных центра: А (аминокислотный) — центр узнавания аминокислоты и П (пептидный) — центр присоединения аминокислоты к пептидной цепочке.

2. Транспортировка аминокислот, присоединенных к тРНК, из цитоплазмы в ФЦР. В активном центре А осуществляется считывание антикодона тРНК с кодоном иРНК, в случае комплементарностн возникает связь, которая служит сигналом для продвижения (скачок) вдоль иРНК рибосомы на один триплет. В результате этого комплекс «кодон рРНК и тРНК с аминокислотой» перемещается в активный центр П, где и происходит присоединение аминокислоты к пептидной цепочке (белковой молекуле). После чего тРНК покидает рибосому.

3. Пептидная цепочка удлиняется до тех пор, пока не закончится трансляция и рибосома не соскочит с иРНК. На одной иРНК может умещаться одновременно несколько рибосом (полисома). Полипептидная цепочка погружается в канал эндоплазматиче-ской сети и там приобретает вторичную, третичную или четвертичную структуру. Скорость сборки одной молекулы белка, состоящего из 200-300 аминокислот, составляет 1-2 мин. Формула биосинтеза белка: ДНК (транскрипция) —> РНК (трансляция) —> белок.

Завершив один цикл, полисомы могут принять участие в синтезе новых молекул белка.

Отделившаяся от рибосомы молекула белка имеет вид нити, которая биологически неактивна. Биологически функциональной она становится после того, как молекула приобретает вторичную, третичную и четвертичную структуру, т. е. определенную пространственно специфическую конфигурацию. Вторичная и последующие структуры белковой молекулы предопределены в информации, заложенной в чередовании аминокислот, т. е. в первичной структуре белка. Иначе говоря, программа образования глобулы, ее уникальная конфигурация определяются первичной структурой молекулы, которая в свою очередь строится под контролем соответствующего гена.

Скорость синтеза белка обусловлена многими факторами: температурой среды, концентрацией водородных ионов, количеством конечного продукта синтеза, присутствием свободных аминокислот, ионов магния, состоянием рибосом и др.

О происхождении жизни и РНК. Как ученые ищут подтверждение теории РНК-мира

Среди современных концепций зарождения жизни одно из доминирующих положений занимает теория РНК-мира. Попробуем разобраться, что же это такое.

Открытия в молекулярной биологии прошлого столетия привели человечество к пониманию устройства жизни на химическом уровне. Выяснилось, что основу жизнедеятельности любого организма составляют две группы веществ-биополимеров: белки и нуклеиновые кислоты.

Белки, чьи длинные, хитроумно свернутые цепи состоят из десятков и сотен последовательно связанных аминокислот, выполняют в клетке роль рабочих инструментов и универсального строительного материала. Белки-ферменты ускоряют и направляют все химические реакции, протекающие в клетке, формируя ее облик.

Но белки — временные инструменты, потребность в которых постоянно изменяется по ходу жизни организма. Для хранения же информации о белках, а значит, и о строении самого организма природа использует нуклеиновые кислоты — ДНК (дезоксирибонуклеиновую кислоту) и РНК (рибонуклеиновую кислоту). Эти длинные молекулы, построенные из сцепленных между собой четырех видов нуклеотидов, очень похожи по строению, но обладают разными свойствами. Две направленные в разные стороны цепи ДНК формируют жесткую и стабильную двойную спираль длиной в миллионы пар нуклеотидов. РНК же образует сравнительно короткие цепи, подверженные разнообразным химическим реакциям и заплетенные петлями сами на себя.

Структура молекулы ДНК. Изображение: Richard Wheeler / Wikimedia

Столь различная структура объяснила ученым принципиально разные функции ДНК и РНК. ДНК оказалась надежным, долговременным хранилищем информации о белках организма, а РНК — мобильным, коротко живущим переносчиком информации. Она синтезируется белками-полимеразами по ДНК-матрице и отвечает за расшифровку информации, записанной в ДНК, а также за сборку белков по ДНК-чертежу.

Весь этот ворох знаний был накоплен учеными к середине 60-х годов прошлого столетия, став предтечей настоящей биотехнологической революции. Но одновременно он поставил ученых, мучающихся над проблемой зарождения жизни, перед парадоксом.

Для существования первых «живых», то есть способных к размножению и самоподдержанию биохимических систем, достаточно ДНК, РНК и белка. С ролью РНК все вроде бы понятно — типичная молекула на побегушках, которая ничего толком не умеет и не решает, но необходима для переноса информации из ДНК и работы механизмов сборки белка. А вот белки и ДНК явно должны были занимать центральное место в картине доисторического мира.

Информация о структуре белков-катализаторов, умеющих все на свете, способна сохраняться, только будучи записанной в структуре ДНК. Одновременно стабильная ДНК, отлично сохраняя информацию, не способна на самостоятельные химические превращения, кроме, разве что, медленного распада. Что же появилось в эволюции раньше — умелые, короткоживущие белки или надежная, но беспомощная ДНК? Одно никак не может появиться без другого, а случайное одномоментное зарождение сложной ДНК-РНК-белковой самовоспроизводящейся системы казалось невероятным.

Тут взгляды ученых и обратились на РНК. РНК не стабильна и ужасно плохо хранит информацию, но все же хранит ее. А что если допустить, что заплетенные в витиеватые петли цепи РНК смогут работать наподобие белков-ферментов, катализируя, то есть ускоряя, биохимические реакции? Пусть они бы справлялись с этой задачей в сотни раз хуже белков, но гипотетически такие РНК-катализаторы могли бы устойчиво существовать и размножаться на поверхности древней Земли еще до появления белков и ДНК. А их химическая нестабильность была бы даже плюсом, приводя к бешеному темпу эволюции первобытной РНК-фауны.

Структура молекулы предшественника матричной РНК. Изображение: Vossman / Wikimedia

Смелая гипотеза оказалась пророческой, в начале 80-х были найдены первые рибозимы — биокатализаторы на основе РНК. Чуть позже ученые получили аптамеры — молекулы РНК, способные избирательно связывать определенные вещества. Оказалось, что РНК может выполнять работу как по биокатализу, так и по молекулярному распознаванию. Да, у нее это получается хуже, чем у белков, но все же получается.

С тех пор ученые не оставляют настойчивых попыток получить в лаборатории рибозим, способный к устойчивому копированию (репликации) молекул РНК любой структуры. Появившись на заре эволюции, аналогичный рибозим стал бы настоящим «ядром» гипотетического РНК-мира, а его получение было бы осязаемым подтверждением пока еще умозрительной гипотезы.

За годы исследований были получены рибозимы-лигазы, способные сшивать молекулы РНК между собой, и даже рибозимы-полимеразы, копирующие небольшие, однородные по своему нуклеотидному составу фрагменты РНК. Но на всех сложных, способных к биокатализу и молекулярному распознаванию последовательностях они упрямо буксовали, отказываясь работать.

И вот недавно в авторитетном журнале PNAS была опубликована статья о получении первого рибозима, уверенно копирующего РНК-матрицы любого нуклеотидного состава. В ходе экспериментов ученые подменили собой эволюцию: путем искусственного отбора в пробирке им удалось создать рибозим, копирующий РНК с недоступной ранее точностью.

Каждый из 24 раундов мутации-отбора начинался с копирования уже существующего фермента в биохимическом процессе, получившем название рибоПЦР. Эта реакция — аналог хорошо известной полимеразной цепной реакции (ПЦР), позволяющей за несколько часов синтезировать миллионы копий нужного фрагмента ДНК. Для того чтобы в системе появился материал для искусственного отбора, реакция была модифицирована в сторону уменьшения точности копирования. Частота ошибок достигала 10% в пересчете на отдельный нуклеотид. Благодаря этому запланированному случайному мутагенезу ученым удалось получить 1014 (100 триллионов!) различных вариантов исходного рибозима. После завершения реакции мутантные рибозимы придирчиво отбирались учеными: в следующий раунд мутации проходили только самые быстрые и точные рибозимы, способные к наилучшему копированию матрицы.

После завершения этой кропотливой работы исследователи получили рибозим, названный 24-3 полимераза. Впервые в руки ученых попал рибозим, способный реплицировать небольшие цепи РНК любой последовательности. С его помощью удалось реплицировать несколько аптамеров. Затем неутомимой полимеразой был копирован каталитически активный рибозим-лигаза. Но настоящим достижением стало то, что с помощью 24-3 полимеразы удалось реплицировать одну из транспортных РНК. Эти крупные, хитро заплетенные в фигуру наподобие клеверного листа молекулы РНК переносят звенья-аминокислоты к месту сборки белковых цепей и являются важнейшим компонентом аппарата синтеза белка.

Скорость работы полученного рибозима оказалась крайне мала, а производительность несравнима с природными белками-полимеразами, но главное — он был получен, и он работает. Теперь для доказательства возможности существования древнего РНК-мира ученым остался последний шаг — создать рибозим, способный устойчиво реплицировать сам себя. Сделав его, человечество получит в пробирке колонию самокопирующихся молекул РНК — потенциальный аналог первой формы жизни на нашей планете.

Несколько месяцев работы позволили исследователям вплотную приблизиться к созданию искусственного прототипа первобытной жизни. Что же могло получится у естественного отбора за сотни миллионов лет? Еще никогда мы не были так близки к ответу на этот вопрос.

 Дмитрий Лебедев

Миллиард лет эволюции за неделю. Смысл Нобелевской премии по химии в 100 и 500 словах

  • Николай Воронин
  • Корреспондент по вопросам науки и технологий

Автор фото, AFP

Подпись к фото,

Революционное открытие Фрэнсис Арнольд сделала в 1993 году

Нобелевскую премию по химии получили американка Фрэнсис Арнольд и ее коллега Джордж Смит и британец Грегори Винтер — за свои открытия в области направленной эволюции и создание новых белков.

Как было сказано на церемонии, эти ученые «взяли эволюцию под контроль, чтобы принести человечеству наибольшую пользу». Разработанная ими технология производства новых белков широко используется не только в медицине, но и в промышленности.

«Эта отрасль науки давно заждалась своего Нобеля», — утверждает профессор биохимической инженерии Университетского колледжа Лондона Пол Долби.

Так что же именно они изобрели? Русская служба Би-би-си коротко (в 100 словах) и чуть подробнее (в 500 словах) объясняет, в чем суть революционного открытия.

«Неестественный отбор»

Принцип эволюции прост. Под воздействием внешней среды организмы изменяются (мутируют) — и изменения эти происходят в ДНК, то есть в генетическом коде клеток.

Если это помогает организму выжить, то измененную ДНК наследуют его потомки — и изменения закрепляются на генном уровне. Если нет, организм погибает. Так происходит естественный отбор.

Фрэнсис Арнольд придумала, как имитировать этот процесс и фактически направлять эволюцию. Она разработала технологию, которая позволяет вносить изменения в ДНК, где закодирована информация для производства «биологических стройматериалов» организма.

В результате клетка начинает производить новые, ранее не существовавшие ферменты (энзимы) — то есть белки, которые ускоряют химические реакции и могут быть использованы в самых разных целях.

А Смит и Винтер научились использовать оболочку питающихся бактериями вирусов (бактериофагов) для отображения новых белков.

Закодированные учеными протеины выводятся туда, как на экран, именно поэтому их метод получил название «фаговый дисплей».

Как взять эволюцию под контроль

Свое революционное открытие Фрэнсис Арнольд сделала в 1993 году. Тогда ей впервые удалось провести эксперимент в области направленной эволюции и заставить клетку производить новые, ранее не существовавшие ферменты.

Сначала изменения в участки ДНК, кодирующие производимые белки, вносятся довольно хаотично — чтобы просто посмотреть на результат.

Затем включается процесс «неестественного отбора»: из всех произведенных модифицированных ферментов отбираются только те, что могут быть использованы с какой-то целью. Например, будут работать в среде, где был бы бесполезен исходный белок.

По мере изучения новых «эволюционных» энзимов становятся очевидны некоторые закономерности, и довольно скоро в гены уже можно вносить осмысленные изменения, заранее предсказывая получившийся результат.

Проще говоря, методом проб и ошибок Арнольд фактически создала универсальную биологическую микрофабрику, научившись программировать клетки для производства белков с нужными ей свойствами.

Сейчас именно так получают новые энзимы по всему миру. С их помощью создаются новые лекарства, новые виды экологически чистого биотоплива и многое другое.

«Люди давным-давно использовали ферменты в производстве — но только те, что уже и так существовали в природе и лишь случайно открыли свои полезные свойства, — поясняет профессор Университетского колледжа Лондона Пол Долби. — Таких было очень мало, а заставить их работать в промышленных условиях было крайне тяжело».

«Теперь, благодаря работам Арнольд, мы можем самостоятельно изменять энзимы, адаптируя их к работе в промышленных масштабах — а не просто в масштабах клетки. Фактически мы укладываем процесс эволюции, который обычно занимает миллионы или даже миллиарды лет, в рамки буквально одной недели, а то и меньше», — объясняет он.

Как обмануть вирус

Джордж Смит и Грегори Винтер также придумали, как «обманывать эволюцию», двигая ее в нужном направлении. Они научились прицельно изменять те участки ДНК вируса, где закодирована информация о его оболочке.

В результате вирус превращается в своеобразный «экран», отображая нужный белок на своей поверхности. Затем вирус заражает бактерию — и та начинает производить этот белок на постоянной основе.

Эта техника, получившая название «фаговый дисплей», позволяет получать новые антитела — крупные белки, при помощи которых наша иммунная система борется с инфекциями. А на их основе — создавать новые лекарственные препараты.

Первое лекарство, полученное при помощи этой методики, прошло клинические испытания и было одобрено еще в 2002 году. Оно открыло новые горизонты в лечении ревматоидного артрита, псориаза и воспалении кишечника. Препарат получил название «Хумира» (адалимумаб) и давно широко используется по всему миру.

И это было только начало. С тех пор на основе той же технологии были созданы препараты, которые могут нейтрализовывать токсины, бороться с ранее неизлечимыми аутоимунными заболеваниями и даже лечить метастазы рака.

«Практически любое современное лечение основано на применении антител и использует технологии вроде фагового дисплея, — говорит профессор Долби. — Это совершенно фундаментальная разработка. И если бы до этого не додумался Джордж Смит, этого бы не произошло никогда».

В одном из интервью Винтер рассказывал об одной своей больной раком пациентке, которой он был вынужден признаться: он понятия не имеет, сработает ли новый метод лечения. В ответ она сказала ему: «Он должен подарить мне хотя бы пару месяцев. Мой муж умирает, и я хочу быть с ним, когда это произойдет».

В итоге лечение оказалось настолько успешным, что опухоль исчезла полностью.

«Спутник V», «ЭпиВакКорона» и «КовиВак»: в чем разница?

Россиянам сейчас доступны три вида отечественных вакцин — «Спутник V» и его демо-версия «Спутник Лайт», «ЭпиВакКорона» и «КовиВак». Какой вакциной лучше привиться и почему? Сколько продлится иммунитет и защитит ли от инфекции?

 

Коротко о каждой вакцине в России

«Спутник V» — комбинированная векторная вакцина НИЦ эпидемиологии и микробиологии им. Н. Ф. Гамалеи. В двух дозах вакцины находятся неспособные к размножению аденовирусы-векторы, которые привносят в организм ген коронавирусного S-белка. Интервал между двумя инъекциями — три недели.

«Спутник Лайт» представляет собой первый компонент «Спутника V», который вводится однократно.

«ЭпиВакКорона» — пептидная вакцина, созданная ФБУН ГНЦ ВБ «Вектор», которая состоит из искусственно синтезированных коротких фрагментов вирусных белков. С их помощью иммунная система обучается узнавать и ликвидировать вирус. Интервал между двумя инъекциями — три недели

«КовиВак» — цельновирионная вакцина, созданная Центром им. Чумакова. В ее основе SARS-CoV-2, лишенный инфекционных свойств, но способный вызывать иммунную реакцию. Интервал между двумя инъекциями две недели.

Признаны ли вакцины в мире?

«Спутник V» зарегистрирован 11 августа 2020 года и прошел все три фазы клинических испытаний, а публикации с результатами финальных испытаний вышли в авторитетном научном журнале The Lancet.

Как сообщает Российский фонд прямых инвестиций, применение вакцины «Спутник V» одобрено в более чем 65 странах. Вакцина для поставок на зарубежные рынки будет производиться международными партнерами РФПИ в Индии, Бразилии, Китае, Южной Корее и других странах. В то же время вакцина еще не одобрена международными регуляторными агентствами: Всемирной организацией здравоохранения и Европейским медицинским агентством — им не хватает тщательных, оформленных по современным нормам, пострегистрационных исследований и открытой публикации всех данных.

«ЭпиВакКорона» была зарегистрирована 13 октября 2020 года и завершит третью фазу клинических исследований только в конце этого июля, как недавно сообщил гендиректор центра «Вектор» Ринат Максютов. Результаты первой и второй фаз испытаний «ЭпиВакКороны» опубликованы только в российском научном журнале «Инфекция и иммунитет». Статей в международных журналах нет. В мире к «ЭпиВакКороне» относятся осторожно, и контракты о поставках на Петербургском международном экономическом форуме-2021 подписаны пока лишь с бразильскими и венесуэльскими компаниями.

«КовиВак» зарегистрирован 20 февраля 2021 года, выпущен в гражданский оборот в марте. В начале июня начались клинические испытания третьей фазы на добровольцах в девяти городах. Закончатся они только к концу декабря 2022 года. Публикаций в рецензируемых научных журналах по этой вакцине пока не было.

По какому принципу разработаны вакцины?

«Спутник V» создавался так: ученые взяли не слишком патогенный аденовирус человека и лишили его способности длительно воспроизводиться. После этого они встроили в него фрагменты генома, которые кодирует белки и соответствует иммунологически важным белкам коронавируса. Вектором в молекулярной биологии называют некий носитель — им стал аденовирус.

«Попадая в организм, измененный вирус забирается в клетки и строит с их помощью ряд белков, — объясняет ведущий научный сотрудник Института клинической и экспериментальной медицины Александр Чепурнов, экс-сотрудник «Вектора». — После этого иммунная система видит белки коронавируса и вырабатывает антитела к их рецептор-связывающему домену».

«Так вакцина помогает иммунной системе определить «образ потенциального врага», против которого нужно провести обучение».

Александр Чепурнов — ведущий научный сотрудник Института клинической и экспериментальной медицины, экс-сотрудник «Вектора».

И иммунная система вырабатывает различные виды защиты — антитела, Т-клеточный иммунитет.

«ЭпиВакКорона» создана по следующему алгоритму. Взяты самые мелкие белки коронавируса, пептиды, которые ученые по какой-то причине посчитали иммунологически значимыми. Поскольку они мелкие, идея в том, что организм будет отвечать на очень конкретные иммунологические раздражители, а отсутствие большого количества белка сделает вакцину менее реактогенной.

«Но иммунная система такие мелкие белки не видит — чтобы увидела, надо на что-то их посадить, на некий белковый носитель, который может сыграть полезную роль. Посадили на сделанный с помощью технологических фокусов внутренний N-белок, который есть у коронавируса — то есть создали такой образ, где есть внутренний белок, неважный для иммунного ответа, и три фрагмента поверхностного белка, которые посчитали важными», — объясняет Чепурнов.

«КовиВак» называют убитой или инактивированной вакциной — это старинный подход к созданию вакцин, который начали практиковать 250 лет назад. Сначала ученые «нарабатывают» коронавирус — берут культуру клеток, заражают ее вирусом, предварительно его выделив, чтобы он максимально соответствовал штамму, распространенному в стране. Культура клеток вырабатывает много вируса, они разрушаются. Потом эта культура очищается от примесных белков, которые появляются при наработке, его чистят и получают чистую фракцию вируса, которую «убивают». В старину это делали формалином, сейчас появились более современные способы, которые позволяют вирусу не так сильно денатурировать, но делают его неспособным к размножению.

Какая российская вакцина эффективнее?

Нужно иметь в виду, что в мире порядка 5–7% людей вообще не способны вырабатывать иммунитет после вакцинации. Однако вероятность его получить у каждого из нас все же высока.

«Спутник V». Разработчики обещают, что эффективность вакцины составляет 93%, иными словами, из ста человек заболеют семь. Однако тяжесть течения болезни должна быть серьезно ниже. На сайте Стопкоронавирус.рф также отмечается, что антитела обнаружили у 98% добровольцев, клеточный иммунитет сформировался у всех участников испытаний. Иммунитет после прививки оказался в 1,3–1,5 раза выше, чем после перенесенного заболевания. Разработчики препарата обещают, что иммунитет от вакцины сохраняется до двух лет, но эксперты все чаще говорят о 6 месяцах.

«Спутник» — это та вакцина, про которую можно сказать «конь пашет и борозды не портит». Да, есть сомнения по поводу новых штаммов, понятно, что есть больные и тяжелые больные после прививки, но их доля невелика», — отмечает руководитель научного центра молекулярно-генетических исследований ДНКОМ Андрей Исаев. Эксперт добавил, что вакцина зарекомендовала себя в полях, в том числе с точки зрения воздействия на новые штаммы коронавируса «Дельта» и «Дельта+».

«Сомнения по поводу “Спутника” лично у меня отпали, когда я увидел титры нейтрализующих антител. Обычные тесты не показывают, но нейтрализующие антитела видны, когда сыворотку переболевших смешивают с вирусом и смотрят, нейтрализован ли он. Если да, то насколько надо ее развести, чтобы она сохраняла свойства. У гамалеевской вакцины треть сывороток обладали высоким титром. У остальных меньше, но нейтрализующие антитела были во всех случаях. Неплохие отзывы по поводу клеточного иммунитета, он исследовался моими коллегами», — подчеркивает Александр Чепурнов.

«ЭпиВакКороне» разработчики гарантируют стопроцентную иммунологическую эффективность.

Антитела к “ЭпиВакКороне” фиксируются только специальной тест-системой Роспотребнадзора.

«По задумке ученых, она требует взаимодействия Т-клеток с B-клетками, но адъювант в этой вакцине (комплекс дополнительных веществ, усиливающий иммунный ответ), “затачивает” его исключительно на производство B-клеточных антител, которых не видят обычные тесты», — отмечает эксперт.

«КовиВак» — согласно данным Центра им. Чумакова, эффективность вакцины превышает 80%. Статью об этом, как сообщает разработчик, стоит ждать в августе-сентябре. Людям в возрасте 60 и более лет, вероятно, понадобится на одну дозу больше, отмечают «чумаковцы».

«Вируснейтрализующие антитела после “КовиВака” есть, — отмечает Андрей Исаев. — Считается, что он дает комплексный иммунный ответ на все белки коронавируса, а не только на S-белок. Некоторые эксперты полагают, что это непрофильные антитела угнетают иммунитет, но я не уверен, что это может повредить, ведь естественный иммунитет, формируется на базе всех типов антител».

«Иммунный ответ не такой активный, как при “Спутнике”, так как “КовиВак” дает антитела и к другим частям вируса, не столь важным. Может, антител по сумме и больше, но каждое слагаемое мы не мерим и не знаем, какая в итоге защита, — подчеркивает Анча Баранова. — Судя по гражданской статистике, после “КовиВака” средний уровень антител на S-белок все же меньше, чем после “Спутника”, но эта информация требует уточнения».

Какие побочные явления от каждой вакцины?

Отдаленных побочных явлений нет ни у одной, для этого прошло еще слишком мало времени. А вот «быстрые реакции» у каждой свои.

«Спутник» дает подъем температуры каждому второму привитому в день введения и на следующий, иногда ломит мышцы. В инструкции указаны и такие возможные реакции, как тошнота, диспепсия, снижение аппетита и увеличение лимфоузлов.

«После введения второго компонента на следующий день жутко ломило в переносице и области лба, отдавая в глаза — такой головной боли у меня еще не было, — делится привитая 25-летняя девушка в одном из народных чатов в Telegram. — Весь день пролежала, температура колебалась в районе 38, плечо болело. На следующий день все прошло бесследно».

«Вакцинный белок действительно неприятен для организма. По новым данным ученых, он сам по себе обладает некоторыми нейротоксичными свойствами и влияет на свертывание крови. Но при прививке в организме свободного S-белка крайне мало, особенно по сравнению с натуральной инфекцией. Ведь аденовирус производит белок в клетках мышц, а не в центральном кровяном русле.Вакцинация позволяет из двух зол выбрать не просто меньшее, а намного меньшее.» — отметила Анча Баранова профессор Школы системной биологии Университета Джорджа Мейсона

В отношении других негативных последствий эксперт посоветовала не списывать все на прививку, так как у человека и до вакцинации мог быть целый букет заболеваний, в том числе недиагностированных. Если же у него какая-то из систем уже нарушена, вероятность того, что реакция на прививку затронет ее, повышается.

«ЭпиВакКорона»: среди побочных явлений в инструкции указывают боль в месте введения и кратковременное повышение температуры не выше 38,5°С. Но по факту жалоб почти нет, так как вакцина содержит мало белка.

«КовиВак» чаще всего дает аллергические реакции, сонливость, сухость в глазах и минимальную боль в плече. Именно на это жалуются привитые в чатах Telegram:

«Привились “КовиВак” с супругой, нам по 66 лет. И после первой дозы, и после второй особых побочных явлений не было. На третий-пятый день после уколов чувствовалась небольшая слабость, сонливость, при нормальной температуре появился небольшой озноб, тяжесть в голове, желание почаще и побольше поесть. К концу первой недели после укола все отклонения от нормального состояния прошли».

Кому чем прививаться?

Что касается людей с ограничениями по здоровью,  «ЭпиВакКорона» противопоказана людям с первичным иммунодефицитом и злокачественными заболеваниями крови. Делать  «Спутник» на фоне приема препаратов, угнетающих функцию иммунной системы, также нет смысла.

В инструкциях к вакцинам есть предупреждение, что с осторожностью следует вакцинироваться людям с хроническими заболеваниями печени и почек, выраженными нарушениями функции эндокринной системы, сахарным диабетом, тяжелыми заболеваниями системы кроветворения, эпилепсии, а также при инсультах и других заболеваниях центральной нервной системы, заболеваниях сердечно-сосудистой системы, аутоиммунных заболеваниях.

В инструкции к вакцине от Центра им. Гамалеи в этом списке указаны и заболевания легких, астма, атопия и экзема.

«Спутник лайт» — хорошая версия для тех, кто переболел: доказано, что при введении вакцины переболевшим, эффективность ответа вырастает.

«То есть однократная вакцинация переболевшего дает более сильный иммунный ответ, чем двукратная у непереболевшего, — объясняет Чепурнов. — Прививаться можно месяцев через 6–8. И хорошо бы раз в два-три месяца следить, как снижаются антитела. Они бывают различного уровня и с разной интенсивностью и скоростью уходят из организма. Когда они снижаются в 3-4 раза, надо вакцинироваться немедленно».

В целом же вакцины противопоказаны людям с гиперчувствительностью к какому-либо из их компонентов, склонностью к тяжелым аллергическим реакциям и детям. Однако «Спутником» скоро вполне могут начать прививать и беременных.

«По международным стандартам, сначала исследуется основная когорта населения, и только потом — пожилые, дети, беременные, — объясняет врач-терапевт Алексей Водовозов. — По пожилым у нас ограничение уже убрали, а по детям и беременным пока нет. Однако среди 1,5 млрд привитых в мире много женщин, которые не знали, что ждут ребенка или внезапно забеременели после вакцинации».

По его словам, прививку беременные переносят нормально, и младенец рождается с антителами, которые передает ему мать. Антитела ребенок также получает через молоко. Во всем мире ограничения на вакцинацию беременных уже давно сняли, а до изменений инструкций в России дело дошло только сейчас — 28 мая министр здравоохранения РФ Михаил Мурашко заявил, что вносятся изменения в инструкцию по вакцинации от коронавируса для беременных женщин.

По предварительным данным, уже разработана вакцина для несовершеннолетних. Она будет доступна с 1-15 сентября и будет вводиться назально.

У каждого человека в России сегодня есть возможность проявить сознательность и остановить распространение коронавирусной инфекции.

ПРИВИВАЙТЕСЬ !!!

О Бактериофагах

Что такое бактериофаги?

xорошо известно, что бактериофаги умеют адаптироваться к новым условиям благодаря мутациям, но из признаков «живого» им присущи только способность к размножению и передаче потомкам наследственной информации. Именно эти свойства позволили человеку использовать их как альтернативу антибиотикам для борьбы с инфекциями и уничтожения болезнетворных бактерий.


Бактериофаги — это вирусы, мельчайшие природные структуры, похожие на молекулярные кристаллы. Но, в отличие от большинства известных человечеству вирусов, они поражают не высшие организмы (например — человека), а только низшие — одноклеточные, недаром «бактериофаг» буквально переводится как «пожиратель бактерий». Бактериофаги устроены настолько просто, что даже не могут размножаться самостоятельно – для этого им, как и другим вирусам, нужна «чужая» живая клетка.

Из чего состоит бактериофаг

Типичный фаг состоит из «головы» с плотно упакованной генетической программой, состоящей из нуклеиновых кислот (ДНК или РНК), и «хвоста», с помощью которого «впрыскивает» свои гены в клетку бактерии. Зараженная бактерия начинает с помощью собственных внутриклеточных систем и ресурсов синтезировать белки и нуклеиновые кислоты, необходимые для сборки новых вирусных частиц. Зрелые фаги выходят на поиски новой добычи, а «родительская» бактериальная клетка погибает.

Благодаря последним исследованиям стало понятно, что бактериофаги играют важную для поддержания глобального «микробного баланса» роль в биосфере: каждые двое суток они уничтожают половину мировой популяции бактерий и тем самым препятствуют этим быстро размножающимся организмам покрыть толстым слоем земную поверхность. 

Бактериофаги появляются везде, где живут бактерии: на суше и в океанах, в почве и в воде, в растениях и животных. Даже в желудочно-кишечном тракте человека содержится около 1012 бактериофагов – на порядок больше, чем звезд в нашей Галактике! И хотя размер фаговых частиц не превышает 0,0001 мм, биомасса фагов на планете достигает фантастической цифры – 1 млрд тонн. Поэтому эти невидимые глазом, но вездесущие создания называют иногда «темной материей» биосферы.

Преимущества бактериофагов



Бактериофаги – антибактериальные агенты и природные антисептики


Безопасны и не токсичны, не имеют побочных эффектов, применяются у новорождённых детей, беременных и кормящих женщин


Действие бактериофагов не затрагивает полезную микрофлору организма, в отличие от антибиотиков


Бактериофаги совместимы со всеми лекарственными препаратами. Применение бактериофагов не ограничивает использование других лекарств и не влияет на их эффективность


Воздействует лишь на чувствительные к ним болезнетворные бактерии, вызывающие инфекционное заболевание, разрушая их изнутри


Бактериофаги выводятся из организма естественным путем

Применение бактериофагов

Сразу после открытия бактериофагов, препараты на их основе стали использовать для борьбы с инфекционными болезнями человека. Однако в результате изобретения антибиотиков и недостатка знаний о бактериофагах их лечебный потенциал не был реализован.

Спустя полстолетия бактериофагами заинтересовались молекулярные биологи. Они выяснили, что эти простые «наноустройства» с короткими генетическими программами являются удобными объектами для экспериментальных исследований по изучению устройства и работы генома. Дальнейшее изучение фагов и механизмов, с помощью которых бактерии защищаются от врагов, открыло науке один из самых эффективных инструментов редактирования генома – CRISPR-CAS, основанный на системе «бактериального иммунитета».

Фаги нашли применение в разных сферах человеческой деятельности, включая био- и нанотехнологии. Например, как простые системы для наработки белков с заданными свойствами или как основа для создания материалов с заданной архитектурой в каталитической химии.

В качестве «умных» молекулярных устройств их используют для транспорта лекарств в организме и как диагностические сенсоры – например, для выявления патогенных бактерий в продуктах питания. Препараты фагов применяются для дезинфекции в сельском хозяйстве и в пищевой промышленности. Это увеличивает экологическую чистоту продуктов.

Но все-таки медицина, как и столетие назад, остается главной областью применения этих врагов бактерий. С ростом лекарственной устойчивости бактерий к химическим антибиотикам возросло значение фаготерапии для профилактики и лечения инфекционных болезней человека.

У коротких белков нет причин покидать

J Cell Biol. 2008 Apr 7; 181 (1): 3.

В этом выпуске

Авторские права © 2008, The Rockefeller University Press Эта статья распространяется на условиях лицензии с указанием авторства, некоммерческого использования, общего доступа и запрета зеркальных сайтов в течение первых шести месяцев после даты публикации ( см. http://www.rupress.org/terms). Через шесть месяцев он станет доступен по лицензии Creative Commons License (Attribution – Noncommercial – Share Alike 4.0 Unported License, как описано на http: // creativecommons.org / licenses / by-NC-sa / 4.0 /).

Acell использует простой трюк, чтобы не дать определенным белкам покидать ER: он блокирует их выход из органелл. Ronchi et al. показать, как клетки определяют, какие белки не допускать.

Распределение белков с длинным (красный) и коротким (зеленый) трансмембранным доменом не перекрывается.

Белки, которые должны быть экспортированы из клетки, попадают в ER, где они собираются в пузырьки, которые направляют их в аппарат Гольджи. Один из способов, которым ER предотвращает отправление своих резидентных белков по тому же маршруту, состоит в том, чтобы исключить их из сайтов выхода.Но исследователи не знали, какие характеристики исключают белок. Ronchi et al. подозревали, что ER сортирует белки по их трансмембранному домену (TMD).

Чтобы проверить эту идею, исследователи изменили человеческие клетки, чтобы произвести два идентичных белка, за исключением их TMD, длина которой составляла 22 аминокислоты в одной молекуле и 17 — в другой. Команда ранее показала, что более длинный белок покидает ER, а более короткий остается. Новая работа показывает, что белок из 17 аминокислот имеет тенденцию избегать сайтов выхода ER.Однако более длинный белок перемещался в эти места и выходил из них, и небольшое его количество накапливалось там.

Куда попадет каждый белок, может зависеть от того, с какими липидами он связан, предполагают исследователи. Поскольку его TMD длиннее и более гидрофобен, версия из 22 аминокислот может искать более жесткие липидные домены, которые могут собираться в местах выхода. Более короткий белок, напротив, лучше подходит для менее упорядоченных и более тонких участков мембраны.

Артикул:

Рончи, П., и другие. 2008. J. Cell Biol. 181: 105–118. [Бесплатная статья PMC] [PubMed] [Google Scholar]

Искусственный интеллект DeepMind делает гигантский скачок в решении белковых структур

Функция белка определяется его трехмерной формой Фото: DeepMind

Сеть искусственного интеллекта (AI), разработанная Google AI, ответвлением DeepMind, сделала гигантский скачок в решении одной из величайших задач биологии — определении трехмерной формы белка по его аминокислотной последовательности.

Программа DeepMind под названием AlphaFold превзошла около 100 других команд в двухгодичной задаче прогнозирования структуры белка под названием CASP, сокращенно от Critical Assessment of Structure Prediction. Результаты были объявлены 30 ноября в начале конференции — практически в этом году — которая подводит итоги работы.

«Это большое дело», — говорит Джон Моулт, вычислительный биолог из Университета Мэриленда в Колледж-Парке, который стал соучредителем CASP в 1994 году с целью улучшения вычислительных методов для точного предсказания структур белков.«В каком-то смысле проблема решена».

Возможность точно предсказать белковые структуры по их аминокислотной последовательности была бы огромным благом для наук о жизни и медицины. Это значительно ускорит усилия по пониманию строительных блоков клеток и позволит быстрее и эффективнее открывать новые лекарства.

AlphaFold занял первое место на последнем CASP — в 2018 году, первом году участия лондонской DeepMind. Но в этом году сеть глубокого обучения этого подразделения была на голову выше других команд и, по словам ученых, работала настолько ошеломляюще, что могла возвестить революцию в биологии.

«Это меняет правила игры», — говорит Андрей Лупас, биолог-эволюционист из Института биологии развития им. Макса Планка в Тюбингене, Германия, который оценивал эффективность различных команд в рамках CASP. AlphaFold уже помог ему найти структуру белка, которая беспокоила его лабораторию в течение десяти лет, и он ожидает, что это изменит то, как он работает, и какие вопросы он решает. «Это изменит медицину. Это изменит исследования. Это изменит биоинженерию. Это все изменит », — добавляет Лупас.

В некоторых случаях предсказания структуры AlphaFold были неотличимы от тех, которые были получены с помощью экспериментальных методов «золотого стандарта», таких как рентгеновская кристаллография и, в последние годы, криоэлектронная микроскопия (крио-ЭМ). AlphaFold может и не избавить от необходимости в этих трудоемких и дорогостоящих методах — пока, — говорят ученые, но ИИ позволит изучать живые существа по-новому.

Структурная проблема

Белки — это строительные блоки жизни, ответственные за большую часть того, что происходит внутри клеток.Как работает белок и что он делает, определяется его трехмерной формой — «структура есть функция» — аксиома молекулярной биологии. Белки склонны принимать форму без посторонней помощи, руководствуясь только законами физики.

На протяжении десятилетий лабораторные эксперименты были основным способом получения хороших белковых структур. Первые полные структуры белков были определены, начиная с 1950-х годов, с использованием техники, в которой рентгеновские лучи направляются на кристаллизованные белки, а дифрагированный свет переводится в координаты атомов белка.Рентгеновская кристаллография позволила получить львиную долю белковых структур. Но за последнее десятилетие крио-ЭМ стала излюбленным инструментом многих структурно-биологических лабораторий.

Ученые давно задавались вопросом, как составные части белка — цепочка различных аминокислот — отображают множество изгибов и складок его окончательной формы. Исследователи утверждают, что ранние попытки использовать компьютеры для предсказания структуры белков в 1980-х и 1990-х годах не увенчались успехом. Высокие заявления о методах в опубликованных статьях имели тенденцию рассыпаться, когда другие ученые применяли их к другим белкам.

Moult запустил CASP, чтобы усилить эти усилия. Событие ставит перед командами задачу предсказать структуры белков, которые были решены с помощью экспериментальных методов, но структуры которых не были обнародованы. Молт считает, что эксперимент — он не называет его соревнованием — значительно улучшил ситуацию, требуя времени на преувеличенные заявления. «Вы действительно понимаете, что выглядит многообещающим, что работает и от чего следует отказаться», — говорит он.

Источник: DeepMind

Выступление

DeepMind на выставке CASP13 в 2018 году поразило многих ученых в этой области, которая долгое время была оплотом небольших академических групп.Но его подход во многом был похож на подходы других команд, применяющих ИИ, говорит Дзинбо Сюй, вычислительный биолог из Чикагского университета, штат Иллинойс.

Первая итерация AlphaFold применила метод искусственного интеллекта, известный как глубокое обучение, к структурным и генетическим данным для прогнозирования расстояния между парами аминокислот в белке. На втором этапе, не использующем ИИ, AlphaFold использует эту информацию для создания «консенсусной» модели того, как должен выглядеть белок, — говорит Джон Джампер из DeepMind, возглавляющий проект.

Команда попыталась развить этот подход, но в итоге упала. Таким образом, по словам Джампера, компания изменила курс и разработала сеть искусственного интеллекта, которая включала дополнительную информацию о физических и геометрических ограничениях, определяющих, как сворачивается белок. Они также поставили перед ним более сложную задачу: вместо того, чтобы предсказывать отношения между аминокислотами, сеть предсказывает окончательную структуру последовательности целевого белка. «Это намного более сложная система, — говорит Джампер.

Поразительная точность

CASP проводится в течение нескольких месяцев.Целевые белки или части белков, называемые доменами — всего около 100 — выпускаются на регулярной основе, и у команд есть несколько недель, чтобы представить свои прогнозы структуры. Затем группа независимых ученых оценивает прогнозы, используя показатели, которые определяют, насколько предсказанный белок похож на экспериментально определенную структуру. Оценщики не знают, кто делает прогноз.

Прогнозы AlphaFold поступали под названием «группа 427», но поразительная точность многих из его записей выделяла их, — говорит Лупас.«Я догадался, что это AlphaFold. У большинства людей это было, — говорит он.

Некоторые прогнозы были лучше других, но почти две трети были сопоставимы по качеству с экспериментальными структурами. В некоторых случаях, говорит Моулт, было неясно, было ли несоответствие между предсказаниями AlphaFold и экспериментальным результатом ошибкой предсказания или артефактом эксперимента.

Предсказания AlphaFold плохо совпадали с экспериментальными структурами, определенными с помощью метода, называемого спектроскопией ядерного магнитного резонанса, но это могло быть связано с тем, как необработанные данные преобразуются в модель, говорит Моулт.Сеть также изо всех сил пытается смоделировать отдельные структуры в белковых комплексах или группах, в результате чего взаимодействие с другими белками искажает их форму.

В целом, команды предсказали структуры в этом году более точно по сравнению с последним CASP, но большая часть прогресса может быть отнесена к AlphaFold, говорит Моулт. По словам Моулта, в отношении целевых белков, которые считаются умеренно сложными, лучшие результаты других команд обычно набирали 75 баллов по 100-балльной шкале точности прогнозов, тогда как AlphaFold набирал около 90 баллов по тем же целям.

Около половины команд упомянули «глубокое обучение» в аннотации, описывающей свой подход, говорит Моулт, предполагая, что ИИ оказывает широкое влияние на эту область. Большинство из них были из академических команд, но Microsoft и китайская технологическая компания Tencent также вошли в CASP14.

Мохаммед Аль-Кураиши, вычислительный биолог из Колумбийского университета в Нью-Йорке и участник CASP, хочет вникнуть в детали выступления AlphaFold на конкурсе и узнать больше о том, как работает система, когда команда DeepMind представит свой подход на 1 декабря.Возможно — но маловероятно, — говорит он, — что более легкий, чем обычно, сбор целевых белков повлиял на производительность. Аль-Кураиши сильно догадывается, что AlphaFold изменит мир.

«Я думаю, будет справедливо сказать, что это будет очень разрушительно для области предсказания структуры белка. Я подозреваю, что многие уйдут с поля, поскольку основная проблема, возможно, уже решена », — говорит он. «Это прорыв первого порядка, безусловно, один из самых значительных научных результатов в моей жизни.”

Демис Хассабис, исполнительный директор DeepMind, говорит, что компания изучает то, что биологи хотят от AlphaFold. Фото: OLI SCARFF / AFP / Getty

Более быстрые структуры

Прогноз AlphaFold помог определить структуру бактериального белка, который лаборатория Лупаса пыталась взломать в течение многих лет. Команда Лупаса ранее собирала необработанные данные дифракции рентгеновских лучей, но преобразование этих структур, подобных Роршаху, в структуру требует некоторой информации о форме белка.Уловки для получения этой информации, как и других инструментов прогнозирования, не увенчались успехом. «Модель из группы 427 дала нам нашу структуру за полчаса, после того как мы все десять лет пробовали», — говорит Лупас.

Демис Хассабис, соучредитель и главный исполнительный директор DeepMind, говорит, что компания планирует сделать AlphaFold полезной, чтобы ее могли использовать другие ученые. (Ранее он опубликовал достаточно подробностей о первой версии AlphaFold, чтобы другие ученые могли воспроизвести этот подход.) AlphaFold может потребоваться несколько дней, чтобы придумать прогнозируемую структуру, которая включает оценки надежности различных участков белка.«Мы только начинаем понимать, чего бы хотели биологи», — добавляет Хассабис, который рассматривает открытие лекарств и разработку белков как потенциальные приложения.

В начале 2020 года компания опубликовала прогнозы структур нескольких белков SARS-CoV-2, которые еще не были определены экспериментально. По словам Стивена Брохона, молекулярного нейробиолога из Калифорнийского университета в Беркли, предсказания DeepMind для белка под названием Orf3a в конечном итоге очень похожи на предсказания, полученные с помощью крио-ЭМ, чья команда опубликовала структуру в июне.«То, что они смогли сделать, очень впечатляет», — добавляет он.

Воздействие в реальном мире

AlphaFold вряд ли закроет лаборатории, такие как Brohawn, которые используют экспериментальные методы для определения структур белков. Но это может означать, что менее качественные и простые для сбора экспериментальные данные — это все, что нужно для создания хорошей структуры. Некоторые приложения, такие как эволюционный анализ белков, будут процветать, потому что цунами доступных геномных данных теперь может быть надежно переведено в структуры.«Это даст возможность новому поколению молекулярных биологов задавать более сложные вопросы», — говорит Лупас. «Это потребует больше размышлений и меньше дозирования».

«Это проблема, которую я начал думать, что не будет решен при моей жизни», — говорит Джанет Торнтон, структурный биолог из Европейской лаборатории молекулярной биологии Европейского института биоинформатики в Хинкстоне, Великобритания, и бывший эксперт CASP. Она надеется, что этот подход поможет пролить свет на функцию тысяч нераскрытых белков в геноме человека и разобраться в вариациях генов, вызывающих болезни, которые различаются у разных людей.

Работа AlphaFold также знаменует собой поворотный момент для DeepMind. Компания наиболее известна тем, что использует ИИ для освоения таких игр, как го, но ее долгосрочная цель — разработать программы, способные обеспечить широкий, человеческий интеллект. По словам Хассабиса, решение грандиозных научных задач, таких как предсказание структуры белка, является одним из наиболее важных приложений, которые может сделать его ИИ. «Я считаю, что это самое важное, что мы сделали с точки зрения реального воздействия».

Обзор анализа белок-белкового взаимодействия | Thermo Fisher Scientific

Белки контролируют все биологические системы в клетке, и хотя многие белки выполняют свои функции независимо, подавляющее большинство белков взаимодействуют с другими для обеспечения надлежащей биологической активности.Характеристика белок-белковых взаимодействий с помощью таких методов, как коиммунопреципитация (ко-IP), анализ методом «pull-down», перекрестное связывание, перенос метки и дальневестерн-блот-анализ имеет решающее значение для понимания функции белка и биологии клетки.

Посмотреть все продукты для анализа взаимодействия белков


Введение в белок-белковые взаимодействия

Белки — это рабочие лошадки, которые способствуют большинству биологических процессов в клетке, включая экспрессию генов, рост клеток, пролиферацию, поглощение питательных веществ, морфологию, подвижность, межклеточную коммуникацию и апоптоз.Но клетки реагируют на множество стимулов, и поэтому экспрессия белка — это динамический процесс; белки, которые используются для выполнения определенных задач, не всегда могут быть экспрессированы или активированы. Кроме того, не все клетки равны, и многие белки экспрессируются в зависимости от типа клетки. Эти основные характеристики белков предполагают сложность, которую может быть трудно исследовать, особенно при попытке понять функцию белка в надлежащем биологическом контексте.

Критические аспекты, необходимые для понимания функции белка, включают:

  • Последовательность и структура белка — используется для обнаружения мотивов, которые предсказывают функцию белка
  • История эволюции и консервативные последовательности — определяет ключевые регуляторные остатки
  • Экспрессия профиль — выявляет специфичность клеточного типа и то, как регулируется экспрессия
  • Посттрансляционные модификации — фосфорилирование, ацилирование, гликозилирование и убиквитинирование предполагают локализацию, активацию и / или функцию
  • Взаимодействия с другими белками — функция может быть экстраполирована зная функцию партнеров по связыванию
  • Внутриклеточная локализация — может указывать на функцию белка

До конца 1990-х годов анализ функции белков в основном фокусировался на отдельных белках.Однако, поскольку большинство белков взаимодействуют с другими белками для правильного функционирования, их следует изучать в контексте их взаимодействующих партнеров, чтобы полностью понять их функцию. С публикацией генома человека и развитием области протеомики понимание того, как белки взаимодействуют друг с другом, и определение биологических сетей стало жизненно важным для понимания того, как белки функционируют в клетке.

Справочник по приготовлению белков

Узнайте больше о том, как обессоливать, заменять буфер, концентрировать и / или удалять загрязняющие вещества из образцов белка, иммунопреципитации и других методах очистки и очистки белков с использованием различных инструментов Thermo Scientific для биологии белков из этого 32-страничного справочника.

  • Иммунопреципитация (IP), co-IP и хроматин-IP
  • Теги очистки рекомбинантного белка
  • Безопасный диализ образцов белка с помощью диализных кассет и устройств Slide-A-Lyzer
  • Быстрое обессоливание образцов с высоким извлечением белка с помощью вращения Zeba колонки и планшеты для обессоливания
  • Эффективное извлечение определенных загрязняющих веществ с помощью смол, оптимизированных для удаления детергентов или эндотоксинов
  • Быстро концентрируйте разбавленные образцы белка с помощью концентраторов белка Pierce

Типы белок-белковых взаимодействий

Белковые взаимодействия в основном характеризуются как стабильные или временные, и оба типа взаимодействия могут быть сильными или слабыми.Стабильные взаимодействия связаны с белками, очищенными как мульти-субъединичные комплексы, и субъединицы этих комплексов могут быть идентичными или разными. Гемоглобин и ядерная РНК-полимераза являются примерами мульти-субъединичных взаимодействий, которые образуют стабильные комплексы.

Ожидается, что временные взаимодействия контролируют большинство клеточных процессов. Как следует из названия, временные взаимодействия носят временный характер и обычно требуют набора условий, которые способствуют взаимодействию, таких как фосфорилирование, конформационные изменения или локализация в дискретных областях клетки.Временные взаимодействия могут быть сильными или слабыми, быстрыми или медленными. Находясь в контакте со своими партнерами по связыванию, временно взаимодействующие белки участвуют в широком спектре клеточных процессов, включая модификацию белков, транспорт, фолдинг, передачу сигналов, апоптоз и клеточный цикл. Следующий пример представляет собой иллюстрацию белковых взаимодействий, которые регулируют апоптотические и антиапоптотические процессы.


Тяжелое белок-белковое взаимодействие BAD. Панель A: окрашенный кумасси гель SDS-PAGE рекомбинантного легкого и тяжелого BAD-GST-HA-6xHIS, очищенный из лизатов HeLa IVT (L) с использованием тандемного сродства глутатионовой смолы (E1) и кобальтовой смолы (E2).Указан расход (FT) из каждого столбца. Панель B: Схема фосфорилирования BAD и белковых взаимодействий во время выживания и гибели клеток (т.е. апоптоза). Панель C: покрытие последовательности белка BAD, показывающее идентифицированные сайты консенсусного фосфорилирования Akt (красный прямоугольник). Панель D: МС-спектры меченного стабильным изотопом BAD пептида HSSYPAGTEDDEGmGEEPSPFr.


Белки связываются друг с другом посредством комбинации гидрофобных связей, сил Ван-дер-Ваальса и солевых мостиков в специфических доменах связывания каждого белка.Эти домены могут быть небольшими связывающими щелями или большими поверхностями и могут состоять всего из нескольких пептидов или состоять из сотен аминокислот. На силу связывания влияет размер связывающего домена. Одним из примеров общего поверхностного домена, который способствует стабильным межбелковым взаимодействиям, является лейциновая молния, которая состоит из α-спиралей на каждом белке, которые связываются друг с другом параллельным образом посредством гидрофобного связывания регулярно расположенных остатков лейцина на каждом α -спираль, которая выступает между соседними спиральными пептидными цепями.Из-за плотной молекулярной упаковки лейциновые молнии обеспечивают стабильное связывание для мультибелковых комплексов, хотя все лейциновые молнии не связываются одинаково из-за нелейциновых аминокислот в α-спирали, которые могут уменьшить молекулярную упаковку и, следовательно, силу взаимодействие.

Два домена гомологии Src (SH), Sh3 и Sh4, являются примерами общих временных связывающих доменов, которые связывают короткие пептидные последовательности и обычно обнаруживаются в сигнальных белках. Домен Sh3 распознает пептидные последовательности с фосфорилированными остатками тирозина, которые часто указывают на активацию белка.Домены Sh3 играют ключевую роль в передаче сигналов рецептора фактора роста, во время которой лиганд-опосредованное фосфорилирование рецептора по остаткам тирозина привлекает нижестоящие эффекторы, которые распознают эти остатки через их домены Sh3. Домен Sh4 обычно распознает богатые пролином пептидные последовательности и обычно используется киназами, фосфолипазами и GTPases для идентификации белков-мишеней. Хотя оба домена Sh3 и Sh4 обычно связываются с этими мотивами, специфичность для различных белковых взаимодействий диктуется соседними аминокислотными остатками в соответствующем мотиве.


Биологические эффекты белок-белковых взаимодействий

Результат двух или более белков, которые взаимодействуют с определенной функциональной целью, можно продемонстрировать несколькими различными способами. Измеримые эффекты белковых взаимодействий описаны следующим образом:

  • Изменение кинетических свойств ферментов, что может быть результатом незначительных изменений в связывании субстрата или аллостерических эффектах
  • Обеспечение канализации субстрата путем перемещения субстрата между доменами или субъединицами , приводя, в конечном итоге, к намеченному конечному продукту
  • Создать новый сайт связывания, обычно для малых эффекторных молекул
  • Инактивировать или разрушить белок
  • Изменить специфичность белка в отношении его субстрата посредством взаимодействия с различными партнерами связывания, например.g., продемонстрировать новую функцию, которую ни один из белков не может проявлять по отдельности
  • Выполняет регуляторную роль либо в восходящем, либо в последующем событии

Общие методы анализа белок-белковых взаимодействий

Обычно для проверки, характеристики и подтверждения белковых взаимодействий необходимо сочетание методов. Ранее неизвестные белки могут быть обнаружены по их ассоциации с одним или несколькими известными белками. Анализ взаимодействия белков может также выявить уникальные, непредвиденные функциональные роли хорошо известных белков.Обнаружение или проверка взаимодействия — это первый шаг на пути к пониманию того, где, как и при каких условиях эти белки взаимодействуют in vivo и функциональные последствия этих взаимодействий.

Хотя различных методов и подходов к изучению межбелковых взаимодействий слишком много, чтобы описать их здесь, в таблице ниже и оставшейся части этого раздела основное внимание уделяется распространенным методам анализа межбелковых взаимодействий и типам взаимодействий, которые могут быть изучены с использованием каждый метод.Таким образом, стабильные белок-белковые взаимодействия легче всего выделить физическими методами, такими как коиммунопреципитация и анализ методом pull-down, поскольку белковый комплекс не распадается с течением времени. Слабые или временные взаимодействия могут быть идентифицированы с использованием этих методов, сначала ковалентно сшивая белки, чтобы заморозить взаимодействие во время co-IP или pull-down. Альтернативно, перекрестное сшивание, наряду с переносом метки и анализом дальнего вестерн-блоттинга, можно проводить независимо от других методов для идентификации межбелковых взаимодействий.

Общие методы анализа различных типов белковых взаимодействий

Метод Взаимодействие белок-белок
Коиммунопреципитация (co-IP) Стабильный или сильный
Стойкий или сильный
9017 Stull-down
Анализ взаимодействия сшивающихся белков Временное или слабое
Анализ взаимодействия белков переноса метки Временное или слабое
Дальневосточный блот-анализ Умеренно стабильный

Коиммунопреципитация (ко-IP)

Коиммунопреципитация (co-IP) — популярный метод обнаружения взаимодействия белков.Co-IP проводится по существу так же, как иммунопреципитация (IP) одного белка, за исключением того, что целевой белок, осажденный антителом, также называемый «приманкой», используется для соосаждения комплекса связывающий партнер / белок. , или «добыча», из лизата. По существу, взаимодействующий белок связывается с антигеном-мишенью, который связывается антителом, иммобилизованным на носителе. Иммунопреципитированные белки и их партнеры по связыванию обычно обнаруживаются электрофорезом в полиакриламидном геле с додецилсульфатом натрия (SDS-PAGE) и вестерн-блоттингом.Предположение, которое обычно делается при соосаждении связанных белков, состоит в том, что эти белки связаны с функцией антигена-мишени на клеточном уровне. Однако это только предположение, которое подлежит дальнейшей проверке.

Совместная иммунопреципитация циклина B и Cdk1 . Магнитные гранулы Thermo Scientific Pierce Protein A / G связываются с антителом Cdk1 в комплексе с Cdk1. Циклин B связан с Cdk1 и захватывается вместе со своим партнером по связыванию.


Анализы Pull-down по методологии аналогичны коиммунопреципитации из-за использования подложки из шариков для очистки взаимодействующих белков. Однако разница между этими двумя подходами заключается в том, что в то время как co-IP использует антитела для захвата белковых комплексов, в методах «pull-down» используется белок «приманка» для очистки любых белков в лизате, которые связываются с приманкой. Нисходящие анализы идеальны для изучения сильных или стабильных взаимодействий или тех, для которых нет антител для коиммунопреципитации.

Общая схема анализа методом выпадающего списка. Нисходящий анализ — это мелкомасштабная методика аффинной очистки, аналогичная иммунопреципитации, за исключением того, что антитело заменяется какой-либо другой системой аффинности. В этом случае аффинная система состоит из глутатион-S-трансферазы (GST), белка или связывающего домена, меченного полигис- или стрептавидином, который захватывается глутатионом, хелатом металла (кобальт или никель) или покрытыми биотином агарозными шариками. , соответственно.Иммобилизованный белок, меченный слиянием, действует как «приманка» для захвата предполагаемого партнера по связыванию (т.е. «жертвы»). В типичном нисходящем анализе иммобилизованный белок-приманка инкубируется с клеточным лизатом, и после предписанных этапов промывки комплексы выборочно элюируются с использованием конкурирующих аналитов или буферов с низким pH или восстанавливающих буферов для анализа в геле или вестерн-блоттинга.


Анализ взаимодействия сшивающего белка

Большинство белок-белковых взаимодействий являются временными, лишь кратковременно происходящими как часть единственного каскада или другой метаболической функции внутри клетки.Сшивание взаимодействующих белков — это подход к стабилизации или постоянному соединению компонентов комплексов взаимодействия. Как только компоненты взаимодействия ковалентно сшиты, другие стадии (например, лизис клеток, аффинная очистка, электрофорез или масс-спектрометрия) могут быть использованы для анализа взаимодействия белок-белок при сохранении исходного взаимодействующего комплекса.

Гомобифункциональные аминореактивные сшивающие агенты могут быть добавлены к клеткам для сшивания потенциально взаимодействующих белков вместе, которые затем могут быть проанализированы после лизиса с помощью вестерн-блоттинга.Сшивающие агенты могут быть мембранопроницаемыми, такими как DSS, для сшивания внутриклеточных белков, или они могут быть непроницаемыми для мембраны, такими как BS3, для сшивания белков клеточной поверхности. Кроме того, некоторые сшивающие агенты могут быть расщеплены восстанавливающими агентами, такими как DSP или DTSSP, для обращения сшивок.

В качестве альтернативы, гетеробифункциональные сшивающие агенты, которые содержат фотоактивируемую группу, такие как продукт SDA или Sulfo-SDA, могут быть использованы для захвата переходных взаимодействий, которые могут происходить, например, после определенного стимула.Фотоактивация также может происходить после метаболического мечения фотоактивируемыми аминокислотами, такими как L-фото-лейцин или L-фото-метионин.

Сайты сшивания между белками можно картировать с высокой точностью с помощью масс-спектрометрии, особенно если используется расщепляемый МС сшивающий агент, такой как DSSO или DSBU.


Анализ взаимодействия белков переноса меток

Перенос метки включает сшивание взаимодействующих молекул (например, белков наживки и жертвы) с меченым сшивающим агентом, а затем расщепление связи между наживкой и добычей, так что метка остается прикрепленной к жертве.Этот метод особенно ценен из-за его способности идентифицировать белки, которые слабо или временно взаимодействуют с интересующим белком. Новые неизотопные реагенты и методы продолжают делать этот метод более доступным и простым в использовании для любого исследователя.

Экспериментальная стратегия переноса биотиновой метки Sulfo-SBED и анализа методом вестерн-блоттинга.


Дальневосточный блот-анализ

Подобно тому, как анализы «pull-down» отличаются от ко-IP в обнаружении белок-белковых взаимодействий с использованием меченых белков вместо антител, так и анализ дальнего вестерн-блоттинга отличается от анализа вестерн-блоттингом , поскольку выявляются белок-белковые взаимодействия. путем инкубации белков, подвергнутых электрофорезу, с очищенным, меченым белком-приманкой вместо антитела, специфичного к целевому белку, соответственно.Термин «далеко» был принят, чтобы подчеркнуть это различие.

Схема дальнего вестерн-блоттинга для анализа белок-белковых взаимодействий. В этом примере меченый белок-приманка используется для зондирования переносящей мембраны или геля на предмет белка жертвы. После связывания антитело, конъюгированное с ферментом (пероксидаза хрена; HRP), которое нацелено на бирку-приманку, используется для обозначения взаимодействия, которое затем обнаруживается ферментативной хемилюминесценцией. Этот общий подход может быть скорректирован с помощью немаркированного белка приманки, который обнаруживается антителами, биотинилированного белка приманки, обнаруживаемого конъюгированным с ферментом стрептавидина, или меченного радиоактивным изотопом белка приманки, обнаруживаемого при воздействии на пленку.


  1. Golemis E (2002) Белковые взаимодействия: руководство по молекулярному клонированию. Колд-Спринг-Харбор (Нью-Йорк): Лабораторная пресса Колд-Спринг-Харбор. p ix, 682.
  2. Phizicky EM, Fields S (1995) Белковые взаимодействия: методы обнаружения и анализа. Microbiol Rev 59: 94–123.

Новая вселенная мини-протеинов меняет клеточную биологию и генетику | Наука

Митч Лесли

Мыши посрамляют бегунов. Несмотря на скромные успехи, грызуны могут преодолевать 10 и более километров за ночь на колесе для упражнений. Но выделялись мыши, которых мышечный биолог Эрик Олсон из Юго-Западного медицинского центра Техасского университета в Далласе и его коллеги представили в 2015 году. На беговой дорожке мыши могли суетиться по крутому склону 10% в течение примерно 90 минут, прежде чем споткнуться, что на 31% дольше, чем у других грызунов. Эти железные мыши отличались от своих собратьев только одним маленьким отличием — исследователи генетически изменили животных так, чтобы им не хватало одного мышечного белка.Этого было достаточно, чтобы развязать превосходную мышечную производительность. «Это как будто вы отключили тормоза», — говорит Олсон.

Не менее поразительной была природа важнейшего белка. В мышцах содержится огромное количество белков. Дистрофин, структурный белок, ген которого может нести мутации, вызывающие мышечную дистрофию, содержит более 3600 аминокислот. Титин, который действует как пружина, придавая мышцам эластичность, является крупнейшим известным белком, содержащим более 34 000 аминокислот. Белок, отключенный у мышей, имеет ничтожное значение 46.Хотя исследователи изучали, как работают мышцы более 150 лет, они полностью упустили из виду огромное влияние этого крошечного белка, называемого миорегулином, на функцию мышц.

Не только Олсон и его коллеги были ошеломлены белками лилипутов. Как теперь понимают ученые, их первоначальные правила анализа геномов дискриминировали идентификацию этих молекул размером с пинту. Теперь более широкие критерии и более совершенные методы обнаружения позволяют обнаруживать крошечные белки тысячами, не только у мышей, но и у многих других видов, включая человека.«Впервые мы собираемся исследовать эту вселенную новых белков, — говорит биохимик Джонатан Вайсман из Калифорнийского университета в Сан-Франциско.

Биологи только начинают изучать функции этих молекул, называемых микропротеинами, микропептидами или минипротеинами. Но их небольшой размер, кажется, позволяет им блокировать сложную работу более крупных белков, подавляя одни клеточные процессы и высвобождая другие. Ранние результаты показывают, что микробелки укрепляют иммунную систему, контролируют разрушение дефектных молекул РНК, защищают бактерии от жары и холода, определяют время цветения растений и обеспечивают токсичный удар для многих типов яда.«Вероятно, там будут небольшие [белки], участвующие во всех биологических процессах. Мы просто не искали их раньше», — говорит биохимик Алан Сагателиан из Института биологических исследований Солка в Сан-Диего, Калифорния.

Яд этого хищного водяного клопа содержит более десятка мелких белков.

ANDREW WALKER

Маленькие белки также обещают пересмотреть текущее понимание генома. Многие из них, по-видимому, закодированы в участках ДНК и РНК, которые, как считалось, не помогают строить какие-либо белки.Некоторые исследователи предполагают, что короткие участки ДНК могут быть генами новорожденных, которые эволюционируют в более крупные гены, которые производят полноразмерные белки. Отчасти благодаря небольшим белкам, «нам нужно переосмыслить, что такое гены», — говорит микробиолог и молекулярный биолог Гизела Сторц из Национального института здоровья детей и развития человека в Бетесде, штат Мэриленд.

Несмотря на остающуюся загадку, ученые уже исследуют потенциальные возможности использования этих молекул. Одна компания продает инсектициды, полученные из небольших белков яда австралийского воронкообразного паука.В ходе клинических испытаний оценивается агент визуализации на основе еще одного крошечного белка в яде скорпиона, предназначенный для выделения границ опухолей, чтобы хирурги могли удалить их более точно. «Многие фармацевтические компании сейчас ищут небольшие белки с медицинским потенциалом», — говорит биохимик Гленн Кинг из Университета Квинсленда в Сент-Люсии, Австралия. «Это одна из самых быстрорастущих областей».

Другие короткие аминокислотные цепи, часто называемые пептидами или полипептидами, изобилуют клетками, но они представляют собой урезанные остатки более крупных предшественников.Миорегулин и его миниатюрные собратья, напротив, рождаются маленькими. Насколько они могут быть крошечными, остается неясным. Как отмечает специалист по геномике микробов Ами Бхатт из Стэнфордского университета в Пало-Альто, Калифорния, плодовые мушки полагаются на микропротеин с 11 аминокислотами для роста нормальных ног, а некоторые микробы могут вырабатывать белки длиной менее 10 аминокислот. Но даже самые большие маленькие белки не соответствуют белкам среднего размера, таким как альфа-амилаза, фермент из 496 аминокислот в нашей слюне, который расщепляет крахмал.

До недавнего времени было обнаружено несколько небольших белков из-за критерия идентификации генов, установленного около 20 лет назад. Когда ученые анализируют геном организма, они часто сканируют открытые рамки считывания (ORF), которые представляют собой последовательности ДНК, разграниченные сигналами, которые сообщают рибосомам клетки, ее линиям сборки белка, где начать и где остановиться. Отчасти для того, чтобы избежать большого количества данных, прошлые исследователи обычно исключали любую ORF, которая дала бы белок, содержащий менее 100 аминокислот у эукариот или 50 аминокислот у бактерий.В дрожжах, например, это отсечение ограничивало список ORF примерно до 6000.

Ослабление этого критерия показывает, что клетки несут значительно больше ORF. Ранее в этом году постдок из Стэнфорда Хила Сберро Ливнат, Бхатт и его коллеги исследовали фрагменты генома микробов, населяющих четыре части человеческого тела, включая кишечник и кожу. Путем поиска небольших ORF, которые могут кодировать белки длиной от пяти до 50 аминокислот, исследователи идентифицировали около 4000 семейств потенциальных микропротеинов.Почти половина из них не похожи на известные белки, но последовательность для одной маленькой ORF предполагает, что соответствующий белок находится в рибосомах — это намек на то, что он может играть фундаментальную роль. «Не только гены с эзотерическими функциями были упущены из виду», когда ученые упустили из виду небольшие ОРС, — говорит Бхатт. «Это гены с ключевыми функциями».

Впервые мы собираемся исследовать эту вселенную новых белков.

  • Джонатан Вайсман, Калифорнийский университет, Сан-Франциско

Другие клетки также содержат огромное количество коротких открытых рамок считывания — например, дрожжи могут производить более 260 000 молекул, содержащих от двух до 99 аминокислот.Но клетки почти наверняка не используют все эти открытые рамки считывания, и некоторые из производимых ими аминокислотных цепочек могут не работать. В 2011 году, обнаружив более 600000 коротких ORF в геноме плодовой мушки, генетик по вопросам развития Хуан Пабло Кузо из Университета Сассекса в Брайтоне, Великобритания, и его коллеги попытались сократить это число. Они рассудили, что, если конкретная ORF имеет идентичную или почти идентичную копию у родственного вида, вероятность того, что это геномный мусор, меньше. После поиска генома другой плодовой мушки и анализа других доказательств того, что последовательности транслируются, группа в конечном итоге получила более управляемую цифру в 401 короткую ORF, которая может давать микробелки.Это все равно составляет значительную часть белкового репертуара насекомых — они содержат около 22 000 полноразмерных белков.

Вайсман и его коллеги обнаружили микробелки вторым путем, с помощью метода, который они изобрели для широкого определения того, какие белки производят клетки. Чтобы создать любой белок, клетка сначала копирует ген в информационную РНК. Затем рибосомы считывают мРНК и соединяют аминокислоты в указанном порядке. Посредством секвенирования мРНК, прикрепленных к рибосомам, Вайсман и его команда точно определяют, какие клетки фактически превращаются в белки, а где на РНК рибосома начинает считываться.В исследовании Cell 2011 года он и его команда применили этот метод профилирования рибосом, также называемый Ribo-seq, к эмбриональным стволовым клеткам мыши и обнаружили, что клетки вырабатывают тысячи неожиданных белков, в том числе многие из них ниже 100-аминокислотной — отсечка кислоты. «Было совершенно ясно, что стандартное понимание игнорировало большую вселенную белков, многие из которых были короткими», — говорит Вайсман.

Сагательян и его коллеги применили третий подход, чтобы обнаружить кладезь микробелков в наших собственных клетках.Исследователи использовали масс-спектрометрию, которая включает разбиение белков на части, которые сортируются по массе, чтобы получить отличительный спектр для каждого белка. Сагателян, его тогдашний постдок Сара Славофф и коллеги применили этот метод к смесям белков из человеческих клеток, а затем вычли сигнатуры известных белков. Этот подход позволил выявить спектры 86 ранее не обнаруженных крошечных белков, самые маленькие из которых имеют длину всего 18 аминокислот, сообщили исследователи в 2013 году в статье Nature Chemical Biology .

Малый размер ограничивает возможности белка. Более крупные белки складываются в сложные формы, подходящие для определенной функции, например, для катализирования химических реакций. По словам химика Хулио Камареро из Университета Южной Калифорнии в Лос-Анджелесе, белки с размером меньше 50-60 аминокислот, вероятно, не складываются. Так что они, вероятно, не подходят в качестве ферментов или структурных белков.

Однако их миниатюрные размеры также открывают новые возможности. «Они достаточно крошечные, чтобы поместиться в укромных уголках и трещинах более крупных белков, которые функционируют как каналы и рецепторы», — говорит Олсон.Маленькие белки часто разделяют короткие отрезки аминокислот со своими более крупными партнерами и поэтому могут связываться с этими белками и изменять их активность. Связанные микробелки также могут переносить более крупные молекулы в новые места, например, помогая им проникать в клеточные мембраны.

Микропротеин в яде скорпиона-ловца смерти был слит с флуоресцентным красителем, чтобы опухоли испускали свет в ближнем инфракрасном диапазоне. ( 1 ) Опухоль, видимая в видимом свете ( 2 ) Та же опухоль в видимом и ближнем инфракрасном свете

(Сверху вниз) ИВАН КУЗЬМИН / НАУЧНЫЙ ИСТОЧНИК; BLAZE BIOSCIENCE (2)

Из-за их притяжения к более крупным белкам маленькие белки могут дать клеткам обратимый способ включения или выключения более крупных белков.В исследовании 2016 года, проведенном в PLOS Genetics , биолог по развитию растений Стефан Венкель из Копенгагенского университета и его коллеги генетически изменили растений Arabidopsis , чтобы произвести дополнительные количества двух небольших белков. Обычно растения зацветают, когда дни достаточно длинные, но когда они производят избыточное количество двух микробелков, их цветение откладывается. Маленькие белки вызвали эту задержку, блокируя здоровенный белок CONSTANS, который запускает цветение. Они привязывают CONSTANS к другим ингибирующим белкам, которые его отключают.«Клетка использует то, что помогает ей выжить. Если короткий белок выполняет свою работу, это нормально», — говорит Сагателян.

Эти задания включают в себя другие ключевые задачи. В 2016 году Славофф, Сагательян и его коллеги обнаружили, что человеческие клетки производят 68-аминокислотный белок, который они назвали NoBody, который может помочь управлять разрушением неисправных или ненужных молекул мРНК. Название NoBody отражает его роль в предотвращении образования процессинговых телец (P-телец), загадочных кластеров в цитоплазме, где может происходить распад РНК.Когда белок отсутствует, образуется больше Р-телец, что ускоряет разрушение РНК и изменяет внутреннюю структуру клетки. «Это показывает, что небольшие белки могут оказывать огромное влияние на клетку», — говорит Славофф.

Мышцы зависят от множества микробелков. Во время эмбрионального развития отдельные мышечные клетки сливаются в волокна, обеспечивающие сокращение. Миомиксер из 84 аминокислотных белков объединяется с более крупным белком, чтобы объединить клетки, сообщила команда Олсона в 2017 году в Science .Без него эмбриональные мыши не могут формировать мышцы и почти прозрачны.

Позже миорегулин начинает регулировать мышечную активность. Когда мышца получает стимул, клетки-хранилища выделяют кальций, заставляя волокна сокращаться и генерировать силу. Затем ионный насос SERCA начинает возвращать кальций в запасы, позволяя мышечным волокнам расслабиться. Команда Олсона обнаружила, что миорегулин связывается с SERCA и ингибирует его. Эффект ограничивает частоту сокращения мускулов мыши — возможно, гарантируя, что у животного есть запас мускулов на случай чрезвычайной ситуации, например, при побеге от хищника.Другой небольшой белок, DWORF, имеет противоположный эффект, высвобождая SERCA и позволяя мышце многократно сокращаться.

Даже тщательно изученные организмы, такие как кишечная бактерия Escherichia coli , содержат неожиданные небольшие белки, которые выполняют важные функции. В 2012 году Сторц и ее команда сообщили, что ранее неизвестный белок из 49 аминокислот под названием AcrZ помогает микробу выжить при некоторых антибиотиках, стимулируя насос, который выталкивает лекарства.

А яд, производимый множеством организмов, включая пауков, многоножек, скорпионов и ядовитых моллюсков, изобилует крошечными белками.Многие компоненты яда выводят из строя или убивают, блокируя каналы для натрия или других ионов, которые необходимы для передачи нервных импульсов. Маленькие белки «поражают эти ионные каналы с удивительной специфичностью и эффективностью», — говорит Кинг. «Они являются основными компонентами ядов и ответственны за большинство фармакологических и биологических эффектов».

Австралийский гигантский водный клоп, убивающий рыбу, например, не только полагается на острые когти и похожие на копья рты, чтобы покорить добычу. Он вводит своим жертвам смесь из более чем 130 белков, 15 из которых содержат менее 100 аминокислот, сообщили Кинг и его коллеги в прошлом году.

В отличие от гигантских белков, таких как антитела, микропротеины, доставляемые с помощью таблеток или инъекций, могут проникать в клетки и изменять их функции. Каптоприл, первый из класса лекарств от высокого кровяного давления, известных как ингибиторы ангиотензинпревращающего фермента, был разработан из небольшого белка в яде бразильской гадюки. Но лекарство, которое Управление по санитарному надзору за качеством пищевых продуктов и медикаментов одобрило для продажи в Соединенных Штатах в 1981 году, было обнаружено случайно, до того, как ученые выделили небольшие белки в отдельную группу.На данный момент только несколько микробелков вышли на рынок или в клинические испытания.

Исследователи рака пытаются извлечь выгоду из микробелка из яда скорпиона-ловца смерти ( Leiurus quinquestriatus ) из Африки и Ближнего Востока. Молекула имеет загадочное притяжение к опухолям. Объединив его с флуоресцентным красителем, ученые надеются осветить границы опухолей головного мозга, чтобы хирурги могли безопасно вырезать раковые ткани. «Он освещает опухоль. Вы можете увидеть края и метастазы», ​​- говорит Кинг.В настоящее время проводится клиническое исследование, посвященное оценке того, может ли двойная молекула помочь хирургам удалять опухоли головного мозга у детей.

Насколько важны малые белки для медицины, пока неизвестно, но они уже опровергли несколько биологических предположений. Генетик Норберт Хюбнер из Центра молекулярной медицины Макса Дельбрюка в Берлине и его коллеги обнаружили десятки новых микропротеинов в клетках сердца человека. Группа проследила их до неожиданного источника: короткие последовательности в длинных некодирующих РНК, разновидность, которая, как считалось, не продуцирует белки.После идентификации 169 длинных некодирующих РНК, которые, вероятно, считывались рибосомами, Хюбнер и его команда использовали тип масс-спектрометрии, чтобы подтвердить, что более половины из них дают микробелки в клетках сердца, результат был сообщен ранее в этом году в Cell .

Бактерии, такие как Escherichia coli , также производят множество микробелков, хотя их функции во многих случаях остаются неясными.

KWANGSHIN KIM / SCIENCE SOURCE

Последовательности ДНК для других крошечных белков также встречаются в нетрадиционных местах.Например, некоторые из них находятся рядом с открытыми рамками считывания для более крупных белков. Ранее исследователи думали, что эти последовательности помогают управлять производством более крупных белков, но редко дают начало самим белкам. Некоторые кодирующие последовательности для недавно открытых микробелков даже вложены в последовательности, кодирующие другие, более длинные белки.

Эти геномные сюрпризы могут пролить свет на то, как возникают новые гены, говорит системный биолог Анн-Руксандра Карвунис из Университета Питтсбурга в Пенсильвании.Исследователи думали, что большинство новых генов возникает, когда существующие гены дублируются или сливаются, или когда виды обмениваются ДНК. Но для Карвуниса микробелки предполагают, что протогены могут образовываться, когда мутации создают новые сигналы запуска и остановки в некодирующей части генома. Если полученная в результате ORF продуцирует полезный белок, новые последовательности останутся в геноме и будут подвергаться естественному отбору, в конечном итоге превратившись в более крупные гены, которые кодируют более сложные белки.

В исследовании 2012 года Карвунис, который тогда был постдоком в лаборатории Марка Видаля в Институте рака Дана-Фарбер в Бостоне, и его коллеги обнаружили, что дрожжи переводят более 1000 коротких ORF в белки, что подразумевает, что эти последовательности являются протогенами. .В новом исследовании Карвунис и ее команда проверили, могут ли молодые ORF быть полезными для клеток. Они генетически изменили дрожжи, чтобы увеличить выход 285 недавно разработанных ORF, большинство из которых кодируют молекулы, которые меньше стандартного порогового значения белка или чуть выше него. Для почти 10% белков увеличение их уровней усиливало рост клеток по крайней мере в одной среде. Результаты, опубликованные на сервере препринтов bioRxiv, предполагают, что эти последовательности могут стать полноценными генами, говорит Карвунис.

Славова до сих пор вспоминает, как была поражена, когда во время интервью на постдока с Сагателяном он спросил, не захочет ли она пойти на охоту за маленькими белками. «Я никогда не думал, что может существовать такой размер белков, который до сих пор был для нас темным».

Но ставка окупилась — теперь у нее есть собственная лаборатория по поиску микробелков. Недавно она рассказала некоторым из своих постдоков и аспирантов об одном из наиболее изученных организмов, штамме K12 E.coli. Вскоре команда обнаружила пять новых микробелков. «Мы, вероятно, только царапаем поверхность», — говорит она.

Альтернативный сплайсинг обеспечивает широкий выбор белков для клеток

Семнадцать лет назад завершение проекта «Геном человека» показало, что в геноме человека содержится около 20 000 генов, кодирующих белок — загадочный результат, учитывая нашу сложную биологию. Благодаря продвижению крупномасштабных протеомных исследований за десятилетие, прошедшее после этого рубежа, исследователи поняли, что некоторые клетки человека содержат миллиарды различных полипептидов.Исследователи поняли, что каждый ген может кодировать массив белков. Процесс альтернативного сплайсинга, который впервые наблюдался за 26 лет до завершения проекта «Геном человека», позволяет клетке генерировать разные РНК и, в конечном итоге, разные белки из одного и того же гена. С момента его открытия стало ясно, что альтернативный сплайсинг является обычным явлением и что этот феномен помогает объяснить, как ограниченное количество генов может кодировать организмы ошеломляющей сложности. В то время как менее 40 процентов генов у плодовой мухи подвергаются альтернативному сплайсингу, более 90 процентов генов у человека подвергаются альтернативному сплайсингу.

Альтернативный сплайсинг помогает объяснить, как ограниченное количество генов может кодировать организмы поразительной сложности.

Поразительно, но некоторые гены могут быть альтернативно сплайсированы для генерации до 38 000 различных изоформ транскриптов, и каждый из продуцируемых ими белков выполняет уникальную функцию. Как и главы книги, кодирующие сегменты генома, известные как экзоны, появляются последовательно, а альтернативный сплайсинг работает путем включения или исключения некоторых из этих геномных пассажей.Некоторые главы являются обязательными, то есть они есть в каждом транскрипте, а некоторые являются необязательными, так называемыми альтернативными экзонами. Дифференциальное сплайсинг этих областей из транскрипта РНК создает индивидуализированные и сжатые генетические сообщения. Молекулярные редакторы контролируют сложный поток отбора экзонов, распознавая главы, необходимые для данного белка, и отбрасывая другие. Окончательное расположение экзонов в сплайсированной молекуле РНК формирует структуру и функцию полученного белка.

Хотя еще многое предстоит узнать о том, как работают эти молекулярные редакторы, теперь ясно, что они могут иметь серьезные последствия для истории белка, влияя на то, приведет ли он к здоровому развитию или к болезни.

Открытие сплайсинга РНК

В 1941 году Джордж Бидл и Эдвард Татум основали область молекулярной биологии со своей гипотезой «один ген — один фермент», которая позже была преобразована в один ген — один полипептид. Однако до сих пор неясно, как именно ген кодирует белок.В конце 1950-х годов Фрэнсис Крик представил свою центральную догму молекулярной биологии, объединяющую парадигму, в которой генетическая информация передается от ДНК к РНК и белку. Согласно этой модели, РНК служит промежуточным звеном, предполагая, что молекула представляет собой просто одноразовую копию ДНК. Однако роль РНК оказалась бы гораздо более сложной и важной, чем роль посредника.

Многие разрушительные болезни, по-видимому, частично вызваны дефектами сплайсинга РНК.

В серии экспериментов в 1977 году Сью Бергет, в то время работавшая доктором в лаборатории Фила Шарпа в Массачусетском технологическом институте, продемонстрировала, что вирусная информационная РНК (мРНК) расщеплена, то есть не непрерывна относительно исходной последовательности ДНК.Бергет получил это понимание, выделив вирусный ген и соответствующую ему мРНК, а затем объединив две молекулы так, чтобы при некоторой химической поддержке комплементарные последовательности образовали пары оснований. Любые некомплементарные последовательности будут исключены, образуя петли одноцепочечной ДНК, которые выступают из двухцепочечной молекулы. Бергет, Шарп и их коллеги использовали электронную микроскопию, метод высочайшего разрешения в то время, чтобы визуализировать гибрид РНК-ДНК, и наблюдали множество таких петель.

В том же году Рич Робертс и его коллеги из лаборатории Колд-Спринг-Харбор независимо друг от друга сделали то же открытие. Позже Шарп и Робертс будут совместно удостоены Нобелевской премии по физиологии и медицине за открытие расщепленных генов. В 1978 году Уолли Гилберт, коллега Шарпа, ввел термины «интрон» (внутригенная область) и экзон (экспрессируемая область) для описания этой новой концепции «гены по частям». Это было не только для вирусов. Процесс удаления интронов и соединения кодирующих областей, по-видимому, сохраняется практически у всех организмов в животном мире.Открытие этого основного механизма, известного как сплайсинг РНК, сделало важный дополнительный шаг к центральной догме и подняло вопросы о том, как клетки координируют этот процесс.

Биохимики в 1980-х пытались решить этот вопрос. Используя методы градиентной седиментации и хроматографии, они очистили большие сплайсинговые комплексы и объединили их in vitro, чтобы восстановить процесс отсечения РНК. Растущая популярность масс-спектрометрии на протяжении 1990-х годов в сочетании с растущим числом геномов, загружаемых в репозитории последовательностей, позволила идентифицировать отдельные компоненты сплайсинга.В наши дни мы знаем, что собранный комплекс, сплайсосома, представляет собой массивную молекулярную машину, состоящую из пяти малых ядерных РНК (мяРНК) в ядре, которым может помогать массив из более чем 80 дополнительных белков. Вместе эти комплексы мяРНК-белок образуют небольшие ядерные рибонуклеопротеины (мяРНП, произносится как «snurps»), которые составляют сплайсосому. Как молекулярный редактор мРНК, сплайсосома отличает интроны от экзонов и катализирует их удаление, чтобы связать экзоны и собрать белок.(См. Иллюстрацию ниже.)

Тем не менее, с эволюционной точки зрения идея сплайсинга РНК казалась некоторым исследователям странной. В сентябре 2003 года был запущен проект «Энциклопедия элементов ДНК» (ENCODE) для определения функциональных элементов в геноме человека, и эта попытка вызвала споры о том, являются ли интроны генетическим «мусором», на расшифровку которого клетка тратит драгоценную энергию и ресурсы. только в корзину перед переводом. Альтернативный сплайсинг дал этим, казалось бы, нефункциональным элементам важную роль в экспрессии генов, поскольку в течение следующих нескольких лет появились доказательства того, что внутри интронов находятся последовательности, которые могут способствовать или препятствовать активности сплайсинга.Эти последовательности энхансера и сайленсера распознаются РНК-связывающими белками (RBP), присутствие которых влияет на стыковку и сборку сплайсосом. RBP позволяют объединять или пропускать экзоны или части экзонов в уникальные паттерны, так что один транскрипт может быть сплайсирован в несколько возможных зрелых изоформ мРНК или вариантов сплайсинга, каждый из которых транслируется в белки с потенциально разнообразными функциями. Это опровергло гипотезу Бидла и Татума и продемонстрировало, что, возможно, в истории сращивания было гораздо больше, чем было обнаружено до сих пор.

Как работает альтернативный сплайсинг

Хотя некоторые детали механизмов сплайсинга еще предстоит проработать, известно, что зрелые отредактированные мРНК являются результатом взаимодействия множества факторов внутри и вне самого транскрипта. Среди них — сплайсосома, аппарат, выполняющий сплайсинг.

Каждое событие сплайсинга требует трех компонентов: донора сплайсинга, нуклеотидной последовательности GU на одном конце интрона; акцептор сплайсинга, нуклеотидная последовательность AG на противоположном конце; и точка ветвления, A примерно в 20-40 нуклеотидах от акцептора сплайсинга.Эти три «сайта сплайсинга» распознаются двумя коровыми малыми ядерными РНК (мяРНК) сплайсосомы, U1 и U2, за которыми следует белок U2AF. Связывание этих молекул с транскриптом привлекает еще три мяРНК — U4, U5 и U6, что облегчает реакцию сплайсинга.

На способ сплайсинга транскриптов определенного гена влияет множество факторов. На распознавание экзона сплайсосомой могут влиять РНК-связывающие белки (RBP), которые связываются с мотивами энхансера и сайленсера внутри мРНК и помогают или препятствуют распознаванию сплайсосомами сайтов сплайсинга.А поскольку пре-мРНК часто сплайсируются по мере их транскрипции, скорость транскрипции РНК-полимеразой II дополнительно настраивает окно возможностей для распознавания сайта сплайсинга сплайсосомой.

УЧЕНЫЙ ПЕРСОНАЛ

См. Полную инфографику: WEB | PDF

Вскоре после того, как биохимический механизм, лежащий в основе сплайсинга РНК, был соединен воедино, все больше ученых принялись за сплайсинг и начали изучать его функциональные последствия.Некоторые из самых ранних сообщений появились в конце 1980-х, когда несколько групп, изучающих развитие Drosophila melanogaster независимо друг от друга, отметили, что гены, участвующие в каскаде определения пола мухи, имеют специфические для самок и самцов изоформы сплайсинга, которые определяют сексуальную судьбу мух. Затем ученые начали признавать, что альтернативный сплайсинг обладает исключительной силой в формировании развития и идентичности тканей. В течение следующего десятилетия исследователи опубликовали отдельные примеры, демонстрирующие функциональную роль изоформ сплайсинга в других модельных организмах, от дрожжей и червей до мышей и крыс.

Затем началась гонка по изучению регуляции сплайсинга у людей. В конце 2008 года три отдельные группы во главе с Томом Купером из Медицинского колледжа Бейлора, Крисом Берджем из Массачусетского технологического института и Беном Бленкоу из Университета Торонто опубликовали важные статьи о моделях сплайсинга всего генома в множестве человеческих тканей и клеточных линий. В совокупности их исследования показали, что каждая ткань в организме характеризуется уникальным набором событий сращивания. Четыре года спустя лаборатория Берджа применила эволюционный подход к сравнению альтернативного сплайсинга у видов позвоночных более высокого порядка, включая макаку-резус и корову.Они обнаружили, что мозг, сердце и скелетные мышцы представлены наиболее консервативными и тканеспецифичными альтернативными схемами сплайсинга, что еще раз подчеркивает функциональную важность тканеспецифичного альтернативного сплайсинга.

Новые разработки

Как правило, шаблоны стыковки меняются в процессе разработки. Интересно, что сплайсированные гены чаще всего экспрессируются на одинаковых уровнях во всех органах и на всех стадиях развития. Это предполагает, что сплайсинг может настраивать производство белков, которые возникают в результате этих однородно экспрессируемых генов, в различных контекстах с помощью регуляторов, которые модулируют сплайсинг в зависимости от типа ткани и стадии развития.В самом деле, РНК-связывающие белки приходят и уходят по мере развития, и они берут на себя роль молекулярных переключателей альтернативных событий сплайсинга. Огромное количество возможных комбинаций взаимодействия между последовательностями энхансера и сайленсера и распознающими их RBP вдохновило исследователей принять идею кода сплайсинга — что определенные RBP связываются с определенными мотивами РНК для создания заданного редактирования. Текущие усилия сосредоточены на взломе этого кода. Но определение набора целей RBP чрезвычайно сложно, поскольку RBP может распознавать несколько мотивов в зависимости от биологического контекста.

Сложное и точное действие RBP контролирует альтернативные сети сплайсинга, группы транскриптов из разных генов, каждая из которых является мишенью одной или нескольких одних и тех же RBP. Сеть может координировать конкретную клеточную функцию, которая способствует развитию или гомеостазу тканей. В последние годы группы исследователей сосредоточились на разгадывании этих сетей сращивания. Среди других исследователей лаборатории Берджа и Купера продолжили свое давнее сотрудничество для решения этой задачи на мышах.Две группы секвенировали РНК, чтобы отслеживать экспрессию генов и количество различных изоформ транскриптов во время развития сердечной мышцы, и они наблюдали, что преобразование функции эмбриональных клеток сердца во взрослые происходит параллельно с переходом от профилей сплайсинга плода к взрослым. В качестве постдока в лаборатории Купера одна из нас, Химена Джудис, обнаружила, что многочисленные дифференциально сплайсированные гены кодируют белки, участвующие во внутриклеточном движении, и эти события сплайсинга контролируются двумя RBP: CELF и MBNL.Все признаки указывали на сращивание сети. Последующие исследования показали, что уровни экспрессии CELF и MBNL обратно пропорциональны друг другу во время развития мышц и что они антагонистически регулируют более 1000 транскриптов пре-мРНК, некоторые из которых транслируются в белки, критические для сокращения мышц.

Начиная с первых попыток описать сплайсинг, в учебниках этот процесс считался тем, что он происходит посттранскрипционно. Однако исследователи оспаривают эту точку зрения, демонстрируя, что динамика РНК-полимеразы II (RNAPII) может влиять на сборку сплайсосом, возможно, связывая транскрипцию со сплайсингом.Карла Нойгебауэр и ее лаборатория в Йельском университете отстаивают эту модель и используют биохимические и вычислительные подходы для изучения этого явления. Недавно они разработали метод слежения за интроном одной молекулы (SMIT) для измерения кинетики сплайсинга и обнаружили, что интроны сплайсируются, как только они выходят из RNAPII. В прошлом году международная группа исследователей опубликовала последствий такого котранскрипционного сплайсинга in vivo, показав, что эмбриональные стволовые клетки мыши с нокаутом для медленно транскрибирующейся версии RNAPII обнаруживают дефекты дифференцировки нейронов из-за неспособность правильно сплайсировать гены, участвующие в передаче сигналов синапсов.Это предполагает, что скорость, с которой RNAPII транскрибирует РНК, влияет на способ сплайсинга этой РНК. Исследователи также изучают возможность того, что архитектура и эпигенетика хроматина служат еще одним уровнем регуляции сплайсинга, модулируя скорость транскрипции RNAPII.

Несмотря на множество случаев, разоблачающих механизм альтернативного сращивания и подчеркивающих его функциональные последствия, количество не охарактеризованных событий сращивания огромно, а страницы, документирующие физиологическое значение альтернативного сращивания, в основном остаются пустыми.

Сплайсинг имеет значение

Титин , который кодирует белок в мышцах, является одним из примеров гена, транскрипт пре-мРНК которого может быть сплайсирован несколькими способами с образованием различных изоформ белка. Во время развития сердца плода во время сплайсинга остается больше экзонов, в результате чего образуется относительно длинный упругий белок. Во взрослых сердцах РНК-связывающий белок RBM20 ассоциируется с длинными участками транскрипта мРНК во время сплайсинга, заставляя сплайсосому вырезать эти части ДНК.В результате получается относительно короткий жесткий белок. Если RBM20 отсутствует или дефектен в сердцах взрослых, эти сердца будут производить больше эмбрионального, упругого белка тайтина по сравнению с жесткой взрослой версией. Считается, что это снижает способность сердца сокращаться, что способствует развитию состояния, известного как дилатационная кардиомиопатия.

УЧЕНЫЙ ПЕРСОНАЛ

См. Полную инфографику: WEB | PDF

Неправильное сплайсинг при заболевании

Более одной трети вызывающих заболевание мутаций картируются в сайтах, связанных сплайсосомами или RBP, или с участками генов, кодирующих RBP.Следовательно, неправильное сращивание может быть связано с заболеванием. Болезнь Паркинсона, прогерия, кардиомиопатия, мышечная атрофия позвоночника, миотоническая дистрофия, рак груди, рак яичников — эти разрушительные заболевания и многие другие, по-видимому, частично вызваны дефектами сплайсинга РНК, что подчеркивает ряд вредных эффектов, которые могут возникать даже при незначительном опрокидывании. баланс экспрессии изоформ белка.

Один сценарий включает в себя ген титина ( TTN ), который является рекордсменом по наибольшему количеству экзонов — колоссальным 363 — среди всех генов млекопитающих и кодирует самый большой из известных белков в организме человека, весом в 4 человека. .2 мегадальтона. Белок TTN — это молекулярная пружина, которая способствует эластичности сердечной мышцы. В ходе сердечного развития происходит постепенное увеличение частоты пропуска экзона TTN сплайсосомой, и эти экзоны, таким образом, сплайсируются из мРНК. (См. Иллюстрацию на противоположной странице.) Переход от эмбриональной к взрослой сердечной изоформе тайтина является частью программы нормального развития и управляется RBP, называемым RBM20. Этот RBP способствует пропуску там, где он обнаружен, тем самым вызывая сдвиг в экспрессии белка с длинной эластичной изоформы TTN на короткую жесткую изоформу.Используя модель грызунов, международная когорта исследователей и врачей продемонстрировала, что отсутствие RBM20 вызывает неправильное сплайсинг TTN , что приводит к накоплению длинных эластичных TTN и фенотипов, напоминающих снижение сократимости сердца, наблюдаемое у людей с дилатационной кардиомиопатией, вызванной мутации в RBM20 . Результаты убедительно свидетельствуют о том, что неправильное сплайсинг TTN способствует кардиомиопатии, связанной с RBM20 .

Другой пример — DMD , ген, кодирующий белок дистрофин, который важен для целостности мышц и передачи силы.Мутационные варианты в DMD , как известно, связаны с мышечной дистрофией Дюшенна, заболеванием, которое серьезно нарушает мышечную функцию. (См. «Восстановление мышц», сентябрь 2018 г.) Одна вызывающая заболевание мутация DMD представляет собой мультиэкзонную делецию, которая обычно приводит к сдвигу рамки считывания, начиная с экзона 51. Объединение оставшихся экзонов вместе приводит к укороченному белку дистрофина с нарушенной функцией. Недостаток полностью функционирующего белка дистрофина вызывает мышечную слабость и атрофию, что резко ограничивает физические возможности людей, страдающих этим заболеванием.

Некоторые разрабатываемые в настоящее время методы лечения мышечной дистрофии Дюшенна и других заболеваний направлены на исправление дефектов сплайсинга с целью облегчения симптомов. Например, исследователи смогли частично восстановить функцию дистрофина с помощью антисмысловых олигонуклеотидов, которые не позволяют сплайсосоме распознавать экзоны после делеции. Скрывая эти области от сплайсосомы, экзоны будут пропущены. Затем это может восстановить рамку считывания и произвести почти полноразмерный белок.Два года назад ученые из Национального центра неврологии и психиатрии Японии сообщили о результатах исследования фазы 1, намекающих на безопасность олигонуклеотидов и их способность вызывать пропуск экзонов МДД и у пациентов с мышечной дистрофией Дюшенна.

Понимание истории каждого белка в нашем организме оказалось гораздо более сложным, чем чтение нашей ДНК. Хотя основной механизм сращивания был открыт более 40 лет назад, выяснение взаимосвязи между сращиванием и физиологией продолжает нас увлекать.Мы надеемся, что передовые знания о том, как регулируется альтернативный сплайсинг, и функциональная роль каждой изоформы белка во время развития и болезни, заложат основу для успеха будущих трансляционных терапий.

Габриэль М. Джентиле, Ханна Дж. Виднер и Эмма Р. Хинкль учатся в аспирантуре по программе генетики и молекулярной биологии Университета Северной Каролины в Чапел-Хилл, где Химена Джудиче является доцентом кафедры Клеточная биология и физиология.Джудиче также является членом Института сердца Макаллистера при Медицинском факультете университета.

Исправление (15 января): В этой статье изначально говорилось, что Рич Робертс и его исследовательская группа сделали открытие, описанное в статье 1977 года «Удивительное расположение последовательностей на 5′-концах матричной РНК аденовируса 2». На самом деле не все авторы статьи входили в группу Робертса. Ученый сожалеет об ошибке.

Произошла ошибка при настройке пользовательского файла cookie

Этот сайт использует файлы cookie для повышения производительности.Если ваш браузер не принимает файлы cookie, вы не можете просматривать этот сайт.


Настройка вашего браузера для приема файлов cookie

Существует множество причин, по которым cookie не может быть установлен правильно. Ниже приведены наиболее частые причины:

  • В вашем браузере отключены файлы cookie. Вам необходимо сбросить настройки своего браузера, чтобы он принимал файлы cookie, или чтобы спросить вас, хотите ли вы принимать файлы cookie.
  • Ваш браузер спрашивает вас, хотите ли вы принимать файлы cookie, и вы отказались.Чтобы принять файлы cookie с этого сайта, используйте кнопку «Назад» и примите файлы cookie.
  • Ваш браузер не поддерживает файлы cookie. Если вы подозреваете это, попробуйте другой браузер.
  • Дата на вашем компьютере в прошлом. Если часы вашего компьютера показывают дату до 1 января 1970 г., браузер автоматически забудет файл cookie. Чтобы исправить это, установите правильное время и дату на своем компьютере.
  • Вы установили приложение, которое отслеживает или блокирует установку файлов cookie.Вы должны отключить приложение при входе в систему или проконсультироваться с системным администратором.

Почему этому сайту требуются файлы cookie?

Этот сайт использует файлы cookie для повышения производительности, запоминая, что вы вошли в систему, когда переходите со страницы на страницу. Чтобы предоставить доступ без файлов cookie потребует, чтобы сайт создавал новый сеанс для каждой посещаемой страницы, что замедляет работу системы до неприемлемого уровня.


Что сохраняется в файле cookie?

Этот сайт не хранит ничего, кроме автоматически сгенерированного идентификатора сеанса в cookie; никакая другая информация не фиксируется.

Как правило, в файлах cookie может храниться только информация, которую вы предоставляете, или выбор, который вы делаете при посещении веб-сайта. Например, сайт не может определить ваше имя электронной почты, пока вы не введете его. Разрешение веб-сайту создавать файлы cookie не дает этому или любому другому сайту доступа к остальной части вашего компьютера, и только сайт, который создал файл cookie, может его прочитать.

Когда фермент не является белком? | Особенность

Один из первых принципов, которым учат студентов начальной биохимии, заключается в том, что ферменты — катализаторы, которые могут в миллионы раз ускорять химические реакции в живых системах — являются белками.Это, безусловно, верно для подавляющего большинства ферментов, но это упрощение — точно так же, как традиционное утверждение центральной догмы молекулярной биологии (ДНК создает из РНК белок) является упрощением. Удивительное открытие, сделанное в 1982 году, что молекулы РНК сами по себе могут обладать каталитической активностью, впервые доказало, что нуклеиновые кислоты — это больше, чем просто пассивные носители информации. Теперь мы знаем, что катализ РНК необходим для жизни; мы понимаем химический механизм многих из этих «рибозимов» и начали их реконструировать и конструировать, первоначально в основном в качестве исследовательских инструментов, но с прицелом на применение в качестве переключателей и биосенсоров и, в конечном итоге, в качестве терапевтических средств.

Открытие рибозимов раз и навсегда показало, что РНК является центральным участником жизни клетки.

Томас Чех из Университета Колорадо в США первым открыл молекулу РНК с ферментативной активностью. В конце 1970-х он только что основал свою лабораторию в Колорадо и изучал процессинг нуклеиновых кислот и экспрессию генов у простейших, живущих в прудах, под названием Tetrahymena thermophila . Он заметил, что молекулы РНК этого малоизвестного организма можно разрезать на части или сращивать, если их изолировать в пробирке.«Мы потратили год на поиск белков, участвующих в этой реакции сплайсинга. Поскольку это было настолько быстро и специфично, что его нужно было катализировать с помощью фермента, и, конечно, мы знали, что «все ферменты — это белки», — говорит он. «Нам потребовалось много времени, чтобы понять, что белка не существует, а катализатором была сама РНК. Загрязнение белка Tetrahymena может быть ответственным за реакцию.

Чех также был ответственен за создание названия «рибозим», когда он организовал в своей лаборатории конкурс, чтобы назвать молекулу, которую они обнаружили. «Несколько предложений, которые мы использовали для названия Tetrahymena . Я выбрал более общий «рибозим», но рискнул, потому что наш был единственным известным примером. Мы бы выглядели довольно глупо, если бы он оказался единственным примером или, возможно, обнаружен только у простейших », — поясняет он. Конечно, эти опасения оказались беспочвенными: вторая каталитическая РНК была открыта, когда Сидни Альтман из Йельского университета в США показал, что каталитическая часть РНК-белкового комплекса, обнаруженного у бактерий, РНКаза P, на самом деле была нуклеиновой кислотой. .

Чех и Альтман разделили Нобелевскую премию по химии 1989 года за эти открытия, и теперь мы знаем о рибозимах, которые участвуют во многих различных биохимических процессах: в основном, но не только, в процессинге РНК. «Открытие рибозимов раз и навсегда показало, что РНК является центральным участником жизни клетки, и привело к растущему интересу к РНК и получению еще нескольких Нобелевских премий», — говорит Чех.

Возьмите к нему молоток

Так называемые рибозимы «головки молотка» — названные в честь предполагаемого сходства между ранними двухмерными диаграммами их структуры и акулой — катализируют сайт-специфическое расщепление молекул РНК.Впервые они были обнаружены в середине 1980-х годов у крошечных вирусоподобных патогенов растений, называемых вироидами, но теперь известно, что они встречаются повсюду в природе, в том числе у людей. Структура этих довольно малых РНК и химия простой реакции, которую они катализируют, теперь очень хорошо изучены. Их естественная функция, строго говоря, вовсе не «катализ»: последовательность РНК-мишени расщепляется изомеризацией фосфодиэфирной связи, а сам рибозим потребляется в результате реакции. Первоначально предполагалось, что для этой реакции требуется ион двухвалентного металла, так же как фермент металлопротеиназы требует цинка, но теперь считается, что эти ионы в основном участвуют в стабилизации каркасов РНК.

Рибозимы типа «головка молотка» по своей природе цис-действующие: то есть их естественная активность заключается в расщеплении и, следовательно, в инактивации самих себя. Поскольку это довольно маленькие и простые молекулы, их относительно легко сконструировать так, чтобы они расщепляли внешние субстраты ( trans, -действующее). Кроме того, рибозим в форме головки молотка состоит из консервативного центрального каталитического ядра с двумя «плечами», которые распознают последовательность РНК, подлежащую расщеплению, поэтому довольно просто создать рибозим для расщепления определенной последовательности путем изменения нуклеотидов в плечах.

Несколько групп используют эту технику для создания рибозимов, распознающих и расщепляющих определенные последовательности РНК, как для выяснения молекулярных механизмов in vivo, так и для биотехнологических приложений. Матасора Фукуда и его группа из Университета Фукуока в Японии используют его, чтобы понять некоторые механизмы, участвующие в редактировании РНК. Это название получили процессы, которые изменяют химию оснований в РНК во время или после их транскрипции из ДНК. Редактирование РНК аденозина в инозин (A-to-I), как следует из названия, включает дезаминирование аденина с образованием другого пурина, гипоксантина (инозин является нуклеозидом гипоксантина).Поскольку аденозин расшифровывается как гуанин, он может изменять последовательность белка, когда он встречается в областях, кодирующих белок, и регулирует множество биологических процессов.

Фукуда и его сотрудники использовали общий факт, что рибозимы с головкой молотка могут расщеплять базовую последовательность UAA, но не UGA (U: урацил; A: аденин; G: гуанин), и сходство между гуанозином и инозином для создания структуры рибозима, которая расщепляет сайт-мишень для редактирования РНК, только если не была произведена замена A-to-I.Затем они создали библиотеку рибозимов, содержащих этот центральный мотив, расширенный с каждой стороны случайными последовательностями, и выбрали наиболее стабильный и, следовательно, наиболее активный для дальнейшего тестирования. «Этот рибозим расщепляет неотредактированные последовательности РНК, но не отредактированные, но он был полностью активен только при более высоких концентрациях магния, чем те, которые встречаются в клетках», — говорит Фукуда. «Создание рибозима, который работает при физиологических концентрациях соли, потребует дальнейшей модификации». Аберрации в редактировании РНК A-to-I наблюдались при нескольких заболеваниях, и Фукуда надеется, что в один прекрасный день с использованием аналогичных методов могут быть созданы новые методы лечения, нацеленные на нуклеиновые кислоты. .Однако пока не ясно, являются ли эти отклонения причиной или следствием заболевания. «Первые применения этих методов, вероятно, станут новыми инструментами для исследований в области молекулярной биологии», — добавляет Фукуда.

Первыми приложениями, вероятно, будут инструменты для молекулярной биологии

Роберт Пенчовски из Софийского университета в Болгарии использует аналогичный подход для создания рибозимов, которые обнаруживают и реагируют на присутствие определенных небольших молекул. Аптамер — это короткая последовательность нуклеиновой кислоты или небольшой белок, который связывается с данной молекулярной мишенью.Большинство аптамеров являются синтетическими, а аллостерические рибозимы — те, которые активны только с лигандом, связанным вне каталитического домена, — могут быть созданы путем слияния РНК-аптамера, содержащего сайт связывания, например, с каталитическим рибозимом в форме головки молотка.

Penchovsky использовал компьютерное моделирование для создания молекул этого типа, в которых рибозим меняет конформацию между активным и неактивным состояниями в ответ на теофиллин, пурин, который химически подобен кофеину. «Эти простые рибозимы могут действовать как ворота молекулярной логики с функцией ДА логической логики, если связывание теофиллина активирует рибозим, и функция НЕ, если связывание дезактивирует его», — говорит Пенчовски.«Я также могу разработать олигонуклеотид-чувствительные рибозимы, которые действуют как логические элементы И и ИЛИ, и аналогичные биосенсорные системы уже использовались в высокопроизводительных скрининговых массивах для открытия антибактериальных препаратов». Есть и другие потенциальные применения этой технологии в молекулярных вычислениях и антибиотиках. дизайн, и Penchovsky ищет промышленных сотрудников для их дальнейшего развития.

Рибосома

Рибозимы «Голова молотка» — это довольно маленькие, легко поддающиеся обработке молекулы, которые можно относительно легко синтезировать.Однако есть и другие биологически важные рибозимы, которые находятся прямо на другом конце макромолекулярного спектра. Рибосома, «молекулярная машина», которая катализирует синтез белка и находится во всех живых клетках, имеет две субъединицы, которые объединяются только во время синтеза белка, и каждая субъединица включает множество молекул белка и РНК. Когда была опубликована первая структура большой субъединицы с высоким разрешением, задействованные исследователи, Том Стейтц и его группа из Йельского университета, прокомментировали, что белки присутствуют повсюду на поверхности субъединицы, кроме активного центра, где происходит образование пептидной связи и где она контактирует. малая субъединица ».Стейтц и его коллеги пришли к выводу, что очень неожиданно именно молекулы РНК были главным образом, если не исключительно, вовлечены в синтез пептидов, а белки выступали в качестве «скрепок», чтобы удерживать их на месте. Они установили, что рибосома — это рибозим.

Венки Рамакришнан из лаборатории молекулярной биологии MRC в Кембридже, Великобритания, разделил Нобелевскую премию по химии 2009 года за исследования рибосомы вместе со Стейтцем и Адой Йонат из Института Вейцмана в Израиле.Он посвятил много недавних исследований пониманию механизма, с помощью которого рибосома распознает три нуклеотида, которые образуют «стоп-кодон», прекращает синтез белка и высвобождает вновь образованный белок. Стандартный генетический код использует три стоп-кодона, UAA, UGA и UAG, и замечательные структурные исследования Рамакришнана, в которых использовались электронная микроскопия, а также кристаллография, показали, как эукариотический белок, известный как фактор высвобождения, может, будучи связанным с рибосомой, использовать основание стекинг и водородная связь для распознавания этих триплетов оснований, но не других.Интересно, что это тоже можно сравнить с логическим вентилем логической логики, в данном случае вентилем И-НЕ с G, представленным 1 и A, равным 0. Любая комбинация этих двух нуклеотидов, кроме ‘GG’ (’11’) в положения второго и третьего кодона будут сигнализировать о прекращении синтеза белка.

Эти и другие открытия показывают, что молекулы РНК способны катализировать полный минимальный набор химических реакций, необходимых для жизни, и это привело к теории происхождения жизни, названной «миром РНК».Это говорит о том, что, поскольку молекулы РНК способны самовоспроизводиться и сочетать ДНК-подобную функцию хранения информации с белковоподобной функцией химического катализа, вся жизнь на Земле могла развиться из примитивных «организмов», состоящих только из РНК. . «Невозможно доказать эту теорию, поскольку не существует молекулярных окаменелостей, но вся информация, которую мы накопили о рибозимах и РНК, предполагает, что это не только возможно, но и вероятно», — говорит Чех.

Обретение контроля

Невозможно даже представить себе ученых, которые в ближайшее время создадут рибозим, который по своей структуре и функциям был бы таким же сложным, как рибосома.Но исследователи уже работают с натуральными рибосомами, чтобы незаметно изменить их свойства. Первоначально это было ограничено их неспособностью контролировать, какие из имеющихся больших и малых рибосомных субъединиц будут образовывать активные комплексы. Однако теперь несколько групп, включая Джейсона Чина из Лаборатории молекулярной биологии MRC, Александра Манкина из Университета Иллинойса и Майкла Джуэтта из Северо-Западного университета в США, показали, что можно создать полностью ортогональные рибосомы с субъединицами, которые были соединены ковалентными линкерами и все еще каталитически активны.

Манкин, Джуэтт и их команды разработали «привязанную» рибосому, в которой к одному РНК-компоненту каждой из большой и малой субъединиц рибосомы E. coli присоединены два полиаденозиновых нуклеотида. «Эти линкеры должны быть достаточно длинными, чтобы гарантировать, что субъединицы могут производить весь спектр конформационных изменений, необходимых для синтеза белка, но достаточно короткими, чтобы предотвратить связывание любой субъединицы с другой рибосомой», — объясняет Манкин.«Один линкер из восьми нуклеотидов и один линкер из девяти нуклеотидов работают очень хорошо». Эти рибосомы, получившие название Ribo-T, могут катализировать синтез белка в клетках E. coli , даже если рибосомы дикого типа отсутствуют, хотя бактерии без рибосомы дикого типа растут вдвое медленнее. «Мы используем Ribo-T для дальнейшего изучения механизма синтеза белка, и мы сможем создавать привязанные рибосомы с необычными функциями, в конечном итоге даже заставляя их синтезировать полимеры, отличные от белков», — добавляет Джеветт.

Рибосома — не единственная большая молекулярная машина, которая, как было показано, является рибозимом. Гены большинства эукариот содержат некодирующие сегменты, называемые интронами, которые необходимо удалить из транскрибированной информационной РНК, прежде чем они достигнут рибосомы. Этот процесс, в котором РНК расщепляется в начале и в конце каждого интрона, а затем повторно соединяются кодирующие белок последовательности экзонов, называется сплайсингом, а комплекс белок-РНК, который катализирует эту реакцию, является сплайсосомой. Он состоит из пяти небольших молекул РНК, белковых комплексов и ионов магния, и опять же, каталитическая единица формируется из РНК и стабилизируется белками и ионами.Структура РНК-компонента сплайсосомы очень похожа на структуру рибозима гораздо меньшего размера, самосплайсингового интрона группы II, который находится в геномах всех организмов. «Белки стабилизируют структуру интронов группы II и усиливают их активность, хотя они не являются необходимыми для катализа», — объясняет Киёси Нагаи из лаборатории молекулярной биологии MRC.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *